Os06t0708000-04

Locus

Os06g0708000

Description

Mitogen-activated protein kinase, Defense response

RAP-DB Gene Symbol Synonym(s)

BWMK1, OsBWMK1M

RAP-DB Gene Name Synonym(s)

BLAST- AND WOUND- INDUCIBLE MAPK GENE 1

CGSNL Gene Symbol

BWMK1

CGSNL Gene Name

BLAST- AND WOUND- INDUCIBLE MAPK GENE 1

Oryzabase Gene Symbol Synonym(s)

OsBWMK1, MPK12, MAPK1, OsMAPK1, OsMPK12, OsMPK17-1, MPK17-1, OsBWMK1L, OsBWMK1M, OsBWMK1S, OsMAPK17-1, MAPK17-1, MAPK12, OsMAPK12

Oryzabase Gene Name Synonym(s)

blast- and wound- inducible MAPK gene-1, Blast- and wound-induced MAP kinase 1, Mitogen-activated protein kinase 12, MAP kinase 12, MAP kinase 1, MAP kinase 17

Transcript Evidence

Inferred from literature

Protein Evidence

Inferred from literature

Literature

PMID: 17586462

Note

Manual Curation

October 10, 2015

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: MAP kinase activity (GO:0004707)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain (IPR011009)

Protein kinase domain (IPR000719)

Serine/threonine/dual specificity protein kinase, catalytic domain (IPR002290)

Protein kinase, ATP binding site (IPR017441)

Mitogen-activated protein (MAP) kinase, conserved site (IPR003527)

Others

Oryzabase (6000)

Transcript

1914 bp

>Os06t0708000-04 Mitogen-activated protein kinase, Defense response
ATGAACACAGTGGAAATGGAGTTCTTCACTGAGTATGGAGAAGCAAGCCAGTACCAGATC
CAGGAAGTCATTGGCAAAGGAAGTTATGGAGTAGTTGCTGCTGCAGTAGATACCCGCACG
GGTGAGCGGGTTGCAATCAAGAAGATCAATGATGTGTTTGAGCATGTATCAGACGCTACG
CGCATATTGCGTGAGATCAAGCTCCTTCGTCTGCTCCGTCACCCAGACATAGTTGAGATC
AAACACATTATGCTTCCCCCTTCTCGAAGGGAGTTCCAAGATATTTATGTTGTTTTTGAG
CTCATGGAATCAGATCTCCATCAAGTCATCAGAGCGAACGATGACCTCACCCCGGAGCAC
TACCAGTTTTTCCTGTACCAACTTCTCCGTGCTCTCAAGTACATCCATGCAGCTAATGTA
TTTCATCGCGATCTAAAGCCCAAGAATATACTGGCAAACTCAGACTGCAAATTGAAAATA
TGTGATTTCGGACTTGCCCGAGCATCATTCAATGATGCCCCTTCAGCAATATTTTGGACG
GATTATGTTGCAACGAGGTGGTACCGAGCACCTGAATTATGTGGCTCATTTTTCTCCAAA
TACACTCCTGCAATTGATATTTGGAGTATTGGGTGCATATTTGCTGAACTTCTCACTGGG
AGACCACTATTTCCTGGGAAGAATGTTGTGCACCAATTAGATATTATAACAGATCTTCTT
GGAACTCCATCATCAGAAACCTTATCCAGGATTCGAAATGAGAAGGCCAGGAGATACTTG
AGCACCATGCGGAAAAAACATGCTGTCCCCTTCTCTCAGAAGTTCCGCAATACTGACCCC
TTGGCTCTTCGTCTGCTAGAGCGTTTACTGGCATTTGATCCTAAAGATCGGTCTTCAGCT
GAAGAAGCTTTGGCTGATCCGTACTTCGCAAGTCTTGCTAATGTGGAACGTGAGCCCTCA
AGACATCCAATCTCAAAACTTGAGTTTGAATTCGAGAGACGGAAGCTGACAAAAGATGAT
GTTAGAGAATTAATTTATCGAGAGATTTTGGAGTATCACCCACAGATGCTGCAAGAGTAT
ATGAAAGGTGGAGAGCAGATTAGCTTCCTCTATCCAAGTGGGGTTGATCGCTTCAAACGA
CAGTTTGCACACCTTGAGGAGAACTACAGCAAAGGAGAAAGAGGTTCTCCACTGCAGAGG
AAGCATGCTTCTTTACCGAGGGAGAGAGTAGGTGTATCAAAGGATGGTTATAACCAACAA
AACACCAATGACCAAGAGAGGAGTGCAGATTCCGTTGCCCGCACTACAGTAAGCCCTCCA
ATGTCACAAGATGCACAACAACATGGATCTGCTGGCCAAAATGGTGTGACATCCACAGAC
TTGAGTTCGAGGAGCTATCTGAAGAGTGCAAGCATTAGTGCTTCCAAGTGTGTCGCTGTC
AAGGACAATAAAGAACCAGAGGATGATTACATCTCTGAAGAAATGGAAGGGTCGGTCGAT
GGATTGTCTGAACAAGTCTCCAGGATGCACTCCTAGTGCACAACGATGACGATGATCAGT
GCAAGATTCTGTGAGGCGCACCAGATGCTGATAATTTCCAAGCAGAATGCTGCACTGCAA
GTTTGGACTTTGGACAATGCAAGTATGCAACAGCCAGCCCGAGATGATTGGCATCTTCTT
ATGCTCATCCATGTTCACATATTCTTCTTGCCATTGTGCTGTCTGTCACTACAGGACCCC
TGCATGGATTAATGTATTATCCCTCTGATGTAACACTAGATTAGTCCATCTGTCCATGGA
GGAATGAATAGCAAGCAGCCAGCTTGTGCATCATGTGGGCATGTTCATTTTCCAGTGAGA
TCTAGTCATATCCATGCTTTTTTTGTAATGGTATATGAAACAGTTTATCAGTGA

CDS

1536 bp

>Os06t0708000-04 Mitogen-activated protein kinase, Defense response
ATGAACACAGTGGAAATGGAGTTCTTCACTGAGTATGGAGAAGCAAGCCAGTACCAGATC
CAGGAAGTCATTGGCAAAGGAAGTTATGGAGTAGTTGCTGCTGCAGTAGATACCCGCACG
GGTGAGCGGGTTGCAATCAAGAAGATCAATGATGTGTTTGAGCATGTATCAGACGCTACG
CGCATATTGCGTGAGATCAAGCTCCTTCGTCTGCTCCGTCACCCAGACATAGTTGAGATC
AAACACATTATGCTTCCCCCTTCTCGAAGGGAGTTCCAAGATATTTATGTTGTTTTTGAG
CTCATGGAATCAGATCTCCATCAAGTCATCAGAGCGAACGATGACCTCACCCCGGAGCAC
TACCAGTTTTTCCTGTACCAACTTCTCCGTGCTCTCAAGTACATCCATGCAGCTAATGTA
TTTCATCGCGATCTAAAGCCCAAGAATATACTGGCAAACTCAGACTGCAAATTGAAAATA
TGTGATTTCGGACTTGCCCGAGCATCATTCAATGATGCCCCTTCAGCAATATTTTGGACG
GATTATGTTGCAACGAGGTGGTACCGAGCACCTGAATTATGTGGCTCATTTTTCTCCAAA
TACACTCCTGCAATTGATATTTGGAGTATTGGGTGCATATTTGCTGAACTTCTCACTGGG
AGACCACTATTTCCTGGGAAGAATGTTGTGCACCAATTAGATATTATAACAGATCTTCTT
GGAACTCCATCATCAGAAACCTTATCCAGGATTCGAAATGAGAAGGCCAGGAGATACTTG
AGCACCATGCGGAAAAAACATGCTGTCCCCTTCTCTCAGAAGTTCCGCAATACTGACCCC
TTGGCTCTTCGTCTGCTAGAGCGTTTACTGGCATTTGATCCTAAAGATCGGTCTTCAGCT
GAAGAAGCTTTGGCTGATCCGTACTTCGCAAGTCTTGCTAATGTGGAACGTGAGCCCTCA
AGACATCCAATCTCAAAACTTGAGTTTGAATTCGAGAGACGGAAGCTGACAAAAGATGAT
GTTAGAGAATTAATTTATCGAGAGATTTTGGAGTATCACCCACAGATGCTGCAAGAGTAT
ATGAAAGGTGGAGAGCAGATTAGCTTCCTCTATCCAAGTGGGGTTGATCGCTTCAAACGA
CAGTTTGCACACCTTGAGGAGAACTACAGCAAAGGAGAAAGAGGTTCTCCACTGCAGAGG
AAGCATGCTTCTTTACCGAGGGAGAGAGTAGGTGTATCAAAGGATGGTTATAACCAACAA
AACACCAATGACCAAGAGAGGAGTGCAGATTCCGTTGCCCGCACTACAGTAAGCCCTCCA
ATGTCACAAGATGCACAACAACATGGATCTGCTGGCCAAAATGGTGTGACATCCACAGAC
TTGAGTTCGAGGAGCTATCTGAAGAGTGCAAGCATTAGTGCTTCCAAGTGTGTCGCTGTC
AAGGACAATAAAGAACCAGAGGATGATTACATCTCTGAAGAAATGGAAGGGTCGGTCGAT
GGATTGTCTGAACAAGTCTCCAGGATGCACTCCTAG

Protein

511 aa

>Os06t0708000-04 Mitogen-activated protein kinase, Defense response
MNTVEMEFFTEYGEASQYQIQEVIGKGSYGVVAAAVDTRTGERVAIKKINDVFEHVSDAT
RILREIKLLRLLRHPDIVEIKHIMLPPSRREFQDIYVVFELMESDLHQVIRANDDLTPEH
YQFFLYQLLRALKYIHAANVFHRDLKPKNILANSDCKLKICDFGLARASFNDAPSAIFWT
DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGRPLFPGKNVVHQLDIITDLL
GTPSSETLSRIRNEKARRYLSTMRKKHAVPFSQKFRNTDPLALRLLERLLAFDPKDRSSA
EEALADPYFASLANVEREPSRHPISKLEFEFERRKLTKDDVRELIYREILEYHPQMLQEY
MKGGEQISFLYPSGVDRFKRQFAHLEENYSKGERGSPLQRKHASLPRERVGVSKDGYNQQ
NTNDQERSADSVARTTVSPPMSQDAQQHGSAGQNGVTSTDLSSRSYLKSASISASKCVAV
KDNKEPEDDYISEEMEGSVDGLSEQVSRMHS*

CDS

chr06:29951040..29951042 (+ strand) : 3 bp

chr06:29951252..29951660 (+ strand) : 409 bp

chr06:29951794..29951921 (+ strand) : 128 bp

chr06:29951995..29952054 (+ strand) : 60 bp

chr06:29952402..29952551 (+ strand) : 150 bp

chr06:29952672..29952827 (+ strand) : 156 bp

chr06:29952946..29953083 (+ strand) : 138 bp

chr06:29953171..29953244 (+ strand) : 74 bp

chr06:29953653..29953754 (+ strand) : 102 bp

chr06:29953852..29954092 (+ strand) : 241 bp

chr06:29954279..29954353 (+ strand) : 75 bp

3'UTR

chr06:29954354..29954731 (+ strand) : 378 bp

FASTA

>Os06t0708000-04 class=Sequence position=chr06:29951040..29954731 (+ strand)
ATGGTATGGA GCAGGTGTTC CTTTCATTTG CGAATAAACC TACATGTCTA TGTACTGAAA ATGTCAATTT TTGTTAGGTT
GGTCATGATA TTCCCAGGGA CAAGATCATG GTTTTGTTTA TAGGGCTATT CTACTACTGA AGAAGTTTTA TAACCAGCCA
CTCTGTATTT TTAGTTAGCT TAATATTTTC TTGCAAAATT GTGATCTTGT AGAACACAGT GGAAATGGAG TTCTTCACTG
AGTATGGAGA AGCAAGCCAG TACCAGATCC AGGAAGTCAT TGGCAAAGGA AGTTATGGAG TAGTTGCTGC TGCAGTAGAT
ACCCGCACGG GTGAGCGGGT TGCAATCAAG AAGATCAATG ATGTGTTTGA GCATGTATCA GACGCTACGC GCATATTGCG
TGAGATCAAG CTCCTTCGTC TGCTCCGTCA CCCAGACATA GTTGAGATCA AACACATTAT GCTTCCCCCT TCTCGAAGGG
AGTTCCAAGA TATTTATGTT GTTTTTGAGC TCATGGAATC AGATCTCCAT CAAGTCATCA GAGCGAACGA TGACCTCACC
CCGGAGCACT ACCAGTTTTT CCTGTACCAA CTTCTCCGTG CTCTCAAGTA CATCCATGCA GGTAAGCTTA ACTACTGATA
ATCCCCAATT CCCCAAGAAC CTACTTGACC ACCATTAAAC ACATAGTTCT GTTGATTTAT CAATTAACAT GGAATTCTAG
CTTATTCTCT GATAAATCAT CTATATTGGC ACAGCTAATG TATTTCATCG CGATCTAAAG CCCAAGAATA TACTGGCAAA
CTCAGACTGC AAATTGAAAA TATGTGATTT CGGACTTGCC CGAGCATCAT TCAATGATGC CCCTTCAGCA ATATTTTGGA
CGGTAAGGTG CTTATATGAG ATTTTACATT CCTCTTTAAG TCTTTATGTT ATTAATTATG TTCTACTTTG TGAAGGATTA
TGTTGCAACG AGGTGGTACC GAGCACCTGA ATTATGTGGC TCATTTTTCT CCAAAGTAAG GTCTTCAACA CTAGAATTCT
TTCAATCAAG ATTAATGCTT TTGTGGCACC ATAGATGAAC TGGTCTAGTT GTTTTTAGCA ATGCTTTCTT TTTTTTTTCC
TTTTTCTTTA TCTATCCAAC TTACAGTTGT GCTAAATGAA GTATAGAAAA TTAAGTTATT TTTCTTTTTG TTGATATTTT
AGTTGTTTGT ACATACAATT TTCTATCAAA GCTGCGCCAC TTGAAACTGG ATGAGTAACA TTCTTGTAGA GAAACAATAT
ACTGTGAACT CTTTTGTGCA ATGCTGATGC TCTAGCGTTC CATGTGTTTT ATGTGTTCTA ACAATAGCCA ATTTGCATAC
AGTACACTCC TGCAATTGAT ATTTGGAGTA TTGGGTGCAT ATTTGCTGAA CTTCTCACTG GGAGACCACT ATTTCCTGGG
AAGAATGTTG TGCACCAATT AGATATTATA ACAGATCTTC TTGGAACTCC ATCATCAGAA ACCTTATCCA GGGTATGTTT
ACTTTATACC GATTCTCATA TATCCTTGAA CCTCCTATTC AGTAACATTC AAGAAGATCC AATTCTCTAA TAAGATGAAA
CAATCACCTT ACTGTTTTCT GCGTCTCTGC AGATTCGAAA TGAGAAGGCC AGGAGATACT TGAGCACCAT GCGGAAAAAA
CATGCTGTCC CCTTCTCTCA GAAGTTCCGC AATACTGACC CCTTGGCTCT TCGTCTGCTA GAGCGTTTAC TGGCATTTGA
TCCTAAAGAT CGGTCTTCAG CTGAAGAAGT AAGCTCAAGA GAAAGCATAG CATCCTTTCC AAACCTCAAA AGTAGTTTTT
TTTTAAAAAA AAAAACTTTC AGAAAACACA CATTTTTTAT ATGTTATATT CTCTTCCAAT TTTCAGGCTT TGGCTGATCC
GTACTTCGCA AGTCTTGCTA ATGTGGAACG TGAGCCCTCA AGACATCCAA TCTCAAAACT TGAGTTTGAA TTCGAGAGAC
GGAAGCTGAC AAAAGATGAT GTTAGAGAAT TAATTTATCG AGAGGTACAA AGCAATAGCT CAAGTTTCCT GCTTTGTGTT
AATAATAAAA TTTTCAGCTT TTCAAGATTG ATAATTATGA AATGCAAACA GATTTTGGAG TATCACCCAC AGATGCTGCA
AGAGTATATG AAAGGTGGAG AGCAGATTAG CTTCCTCTAT CCAAGGTGGA GTCTTGCATT AATTTTTCTT TCTTTCATCA
GTTTTAAATT TGACGTGACA AAGATGAATA TCTGGCTTTG TTCCAGCAAG TTAGCATGGT GTACAATATA CTTCTTTGCA
CCAACAAAAT TGCCTTCGCC AAATACTCTT GTTGGCAAAG CAAATTTACT AAGTATAGTA GTAATTTGCT TTGCAGTGCT
ATCATGAGTT AATATCTGAT CTATTCTTGT TGCTCTCATT TTGGTATATC TTTATTTCCA AGGCTCCTTT CACCCGAAAA
TTGCATGGAC ATTGTTACAG GAAACACTAG CCATGTGTGC ATCTAATATA TATTTATCAT GTCCTTGCAT GGTTTTCTCT
CCTTTTTTTA CCGTGAACAT AGCTATTCTG TTAATATTGT TATCTTACTG CAGTGGGGTT GATCGCTTCA AACGACAGTT
TGCACACCTT GAGGAGAACT ACAGCAAAGG AGAAAGAGGT TCTCCACTGC AGAGGAAGCA TGCTTCTTTA CCGAGGTACA
TAATGTGGCA ATATCAGAAA TCAAAAGTGC AGACCTACTT ACTTTCATAT CAATTATTGT ACTAACTTCT CCATTGATTT
TGCATATAAC AGGGAGAGAG TAGGTGTATC AAAGGATGGT TATAACCAAC AAAACACCAA TGACCAAGAG AGGAGTGCAG
ATTCCGTTGC CCGCACTACA GTAAGCCCTC CAATGTCACA AGATGCACAA CAACATGGAT CTGCTGGCCA AAATGGTGTG
ACATCCACAG ACTTGAGTTC GAGGAGCTAT CTGAAGAGTG CAAGCATTAG TGCTTCCAAG TGTGTCGCTG TCAAGGACAA
TAAAGAACCA GAGGTACTGT TACTTTGCTG CCTGAAATTT GTCTATGATT CTTATAAGTC GGCAAAGTTG CATAGCTATG
CACGATCGAA CAAAAGTATA AGAAATGATG CGTGAAAAGA AAAGGAATTG ACTGGTTTGT TGCATAGGTA GTAACTCCAT
TTCCCTTTGC ATTTCCCTTT TGTTTTTGCT ATCCTTTAGG ATGATTACAT CTCTGAAGAA ATGGAAGGGT CGGTCGATGG
ATTGTCTGAA CAAGTCTCCA GGATGCACTC CTAGTGCACA ACGATGACGA TGATCAGTGC AAGATTCTGT GAGGCGCACC
AGATGCTGAT AATTTCCAAG CAGAATGCTG CACTGCAAGT TTGGACTTTG GACAATGCAA GTATGCAACA GCCAGCCCGA
GATGATTGGC ATCTTCTTAT GCTCATCCAT GTTCACATAT TCTTCTTGCC ATTGTGCTGT CTGTCACTAC AGGACCCCTG
CATGGATTAA TGTATTATCC CTCTGATGTA ACACTAGATT AGTCCATCTG TCCATGGAGG AATGAATAGC AAGCAGCCAG
CTTGTGCATC ATGTGGGCAT GTTCATTTTC CAGTGAGATC TAGTCATATC CATGCTTTTT TTGTAATGGT ATATGAAACA
GTTTATCAGT GA

Locus: Os06g0708000

Loading...

Locus: Os06g0708000

Loading...