Os06t0708400-01

Locus

Os06g0708400

Description

Cyclophilin, Cold tolerance

RAP-DB Gene Symbol Synonym(s)

CYP19-4, OsCYP19-4, OsCYP-16, OsCYP19-3

RAP-DB Gene Name Synonym(s)

CYCLOPHILIN 19-4, cyclophilin 19-4, cyclophilin 16

CGSNL Gene Symbol

CYP19-4

CGSNL Gene Name

CYCLOPHILIN 19-4

Oryzabase Gene Symbol Synonym(s)

OsCYP19-4, OsCYP-16, OsCYP19-3, OsCYP19-4.1, OsCYP19-4.2, OsCYP19-4.3, OsCYP19-4.4, OsCYP19-4.5, OsCYP19-4.6, OsCYP19-4.7, OsCYP19-4.8

Oryzabase Gene Name Synonym(s)

cyclophilin 19-4, cyclophilin 16

Transcript Evidence

Inferred from literature

Protein Evidence

Q5Z9I0

Literature

PMID: 26453745

PMID: 21087465

Note

Manual Curation

November 9, 2015

Gene Ontology (GO)

Biological Process: protein peptidyl-prolyl isomerization (GO:0000413)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Cyclophilin-type peptidyl-prolyl cis-trans isomerase (IPR024936)

Cyclophilin-like domain (IPR029000)

Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain (IPR002130)

Cyclophilin-type peptidyl-prolyl cis-trans isomerase, conserved site (IPR020892)

Expression Databases

TENOR (Os06t0708400-00)

Others

Oryzabase (10059)

Transcript

627 bp

>Os06t0708400-01 Cyclophilin, Cold tolerance
ATGGCGGCGAGGGAGACGTCGCGCCACGCGTCGCTCTGCCTGTGGCTCGCGCTCGTCGCC
GCCACCCTCTCTCTCGCCCAGGCGGTAGAATCAGAAGCCGAATTGACCAAGGTCACCACC
AAGGTCTTCTTCGACATCACAATCAATGGCAAGCCGGCAGGTCGGATTGTCATGGGGCTT
TTTGGAAACACTGTTCCTAAAACAGCAGAGAACTTCCGAGCAATTTGCACAGGTGAGAAA
GGACTTGGCAAGAGTGGCAAACCTCTCTCCTACAAAGGAACGCCATTCCACAGGATCATC
CCAGGCTTCATGATCCAAGGAGGCGACACCGTGAGCGGCAATGGAACCGGCTGTGATTCG
ATCTATGGTGGAATGTTCCCTGATGAGAACTTCAAGATCAACCACTCTGCACCAGGGTTG
CTGTCCATGGCCAACTATGCGAAAGATACAAACGGATCCCAGTTCTTCATCACCACCGTA
AAGCTAACCCGGTTGGATGGGAAGCATGTTGTGTTTGGCAAGGTGCTTTCTGGAATGGAC
GTCGTCTACAAGATTGAAGCTGAAGGCAGTCAGAGTGGTACTCCACGGTCCAAAGTCCTC
ATATCAGACAGCGGCGAACTGAAGTGA

CDS

627 bp

>Os06t0708400-01 Cyclophilin, Cold tolerance
ATGGCGGCGAGGGAGACGTCGCGCCACGCGTCGCTCTGCCTGTGGCTCGCGCTCGTCGCC
GCCACCCTCTCTCTCGCCCAGGCGGTAGAATCAGAAGCCGAATTGACCAAGGTCACCACC
AAGGTCTTCTTCGACATCACAATCAATGGCAAGCCGGCAGGTCGGATTGTCATGGGGCTT
TTTGGAAACACTGTTCCTAAAACAGCAGAGAACTTCCGAGCAATTTGCACAGGTGAGAAA
GGACTTGGCAAGAGTGGCAAACCTCTCTCCTACAAAGGAACGCCATTCCACAGGATCATC
CCAGGCTTCATGATCCAAGGAGGCGACACCGTGAGCGGCAATGGAACCGGCTGTGATTCG
ATCTATGGTGGAATGTTCCCTGATGAGAACTTCAAGATCAACCACTCTGCACCAGGGTTG
CTGTCCATGGCCAACTATGCGAAAGATACAAACGGATCCCAGTTCTTCATCACCACCGTA
AAGCTAACCCGGTTGGATGGGAAGCATGTTGTGTTTGGCAAGGTGCTTTCTGGAATGGAC
GTCGTCTACAAGATTGAAGCTGAAGGCAGTCAGAGTGGTACTCCACGGTCCAAAGTCCTC
ATATCAGACAGCGGCGAACTGAAGTGA

Protein

209 aa

>Os06t0708400-01 Cyclophilin, Cold tolerance
MAARETSRHASLCLWLALVAATLSLAQAVESEAELTKVTTKVFFDITINGKPAGRIVMGL
FGNTVPKTAENFRAICTGEKGLGKSGKPLSYKGTPFHRIIPGFMIQGGDTVSGNGTGCDS
IYGGMFPDENFKINHSAPGLLSMANYAKDTNGSQFFITTVKLTRLDGKHVVFGKVLSGMD
VVYKIEAEGSQSGTPRSKVLISDSGELK*

CDS

chr06:29971111..29971191 (+ strand) : 81 bp

chr06:29971394..29971472 (+ strand) : 79 bp

chr06:29971668..29971715 (+ strand) : 48 bp

chr06:29971809..29971832 (+ strand) : 24 bp

chr06:29972334..29972516 (+ strand) : 183 bp

chr06:29972631..29972706 (+ strand) : 76 bp

chr06:29972838..29972973 (+ strand) : 136 bp

FASTA

>Os06t0708400-01 class=Sequence position=chr06:29971111..29972973 (+ strand)
ATGGCGGCGA GGGAGACGTC GCGCCACGCG TCGCTCTGCC TGTGGCTCGC GCTCGTCGCC GCCACCCTCT CTCTCGCCCA
GGTACTCGAT TGATGATGCT TGCTCATTCT GTTTATATCA TTCACATTGC CCGGATTTTT CCCCTTCAAT TCTTAGTTGC
CACCCTATCA TTAGTTTGCC ACTCTCCCTG ATCTGATCTG ATTACTCGTA CGTCACTCTT CTCCAATGTG TTCGATTTTC
TATTTGTTTT AGAACTTTTG CTCTCTCTGT TTTCTCTTTT CAGGCGGTAG AATCAGAAGC CGAATTGACC AAGGTCACCA
CCAAGGTCTT CTTCGACATC ACAATCAATG GCAAGCCGGC AGGTTTGTGC ATCCTGACTC CCTGATTTCT TGAGTTCACC
AAAATTTTGT TATTGCCTGC TTCTCTGGTA ATAATGCCAT TTATGTATGT TGAAGATTGT TCATTGTTTA ATGAAATCTT
CCATTATCTA AAATAATGCG TGTTTGATTG ATGATATGCT CATTGACGTT TAGATTGTTT CTACTTGGTT GTTATAGGTC
GGATTGTCAT GGGGCTTTTT GGAAACACTG TTCCTAAAAC AGCAGGTATA ACATCAACCT AATTACTTAT TGTTTTCAAC
TTAATTGTTT TTGTCTGAGA CACAAATTGG TAATGGTCTC TGCATCTGCT CTTTGCAGAG AACTTCCGAG CAATTTGCAC
AGGTATTTCT TCCCAACCGT CATACTACAT TTCTTCAATG TAATGCTACC GATTTCATAC AAATTATTTG AAATTATACA
ATTTGGTCAG CTATCCCAAT TCCCAAACGT GAAAGGCTAT ATGTCCTTTT AGTTTTCTTC TCTAAAAGTG TCAAATGAAA
AGGCATATTG CTCGCATCCT TTTTATGTTA TACTATAGGG TTAATACTTA TTGGCATATT CGGTGTTACA TAAGTTATTT
CCTTTATCAC TCTGGGGCCT GTTGGTACTT ACTGAGCATG CCCCAAGTCA TGTACTCCAG TTGATTTGGC TACTATAGTT
CACGAGATTT GGAGAGAGAG ATGTCCCTCC AAACATTTTT TTTAAAGAAA AAATTGCAAG CGTGTTGGCG ATTGAACACG
GGATATCAGG ATTGAAACCA CACACCCCTT GCCACTGCAC TATCAAGTGC ATCTCTTGGC TACTATAGTT TCATGTAGCA
ATCTCAACTT CACATTTATA CAGGTGAGAA AGGACTTGGC AAGAGTGGCA AACCTCTCTC CTACAAAGGA ACGCCATTCC
ACAGGATCAT CCCAGGCTTC ATGATCCAAG GAGGCGACAC CGTGAGCGGC AATGGAACCG GCTGTGATTC GATCTATGGT
GGAATGTTCC CTGATGAGAA CTTCAAGATC AACCACTCTG CACCAGGTGA ACTGCTTTTC TTGATATCCC AGTTGTATAC
TACTATATTA CTGCACAGAA ATTTCATTCT TTTGAGCAGC AAGTCCTCAT GTTTGATTTG CTGGCTGGTC ATTGGTTCAG
GGTTGCTGTC CATGGCCAAC TATGCGAAAG ATACAAACGG ATCCCAGTTC TTCATCACCA CCGTAAAGCT AACCCGGTAA
ACTTCATCAG CTCCTGAGAG CTGAGAATTA GTTTTCGTGC AAATTTTCTT TTTGTTTGCT AGAAATCTTC CGATCAAATT
GTAATTTTGA TCATGACCTA CTCTTTTTGT GTTGTTTGCT ACTGCAGGTT GGATGGGAAG CATGTTGTGT TTGGCAAGGT
GCTTTCTGGA ATGGACGTCG TCTACAAGAT TGAAGCTGAA GGCAGTCAGA GTGGTACTCC ACGGTCCAAA GTCCTCATAT
CAGACAGCGG CGAACTGAAG TGA

Locus: Os06g0708400

Loading...

Locus: Os06g0708400

Loading...