Os06t0708500-01

Locus

Os06g0708500

Description

Similar to Peptidyl-prolyl cis-trans isomerase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP20-1

CGSNL Gene Name

CYCLOPHILIN 20-1

Oryzabase Gene Symbol Synonym(s)

OsCYP20-1, OsCYP-17, OsCYP20-1a, OsCYP20-1b

Oryzabase Gene Name Synonym(s)

cyclophilin 20-1, cyclophilin 17

Transcript Evidence

AK060865 (DDBJ, Best hit)

Protein Evidence

A2YGV2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type, conserved site (IPR020892)

Full-length cDNA

001-034-G11 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0708500-01)

RiceXPro (AK060865)

Others

Oryzabase (10060)

KEGG (Os06t0708500-01 (EC:5.2.1.8))

Transcript

965 bp

>Os06t0708500-01 Similar to Peptidyl-prolyl cis-trans isomerase.
GTGGAGCAACAGATCTATCCATCCATCCCATCCTCGATCCTTCATTCCTGCCCGGCGGCG
AGCGAGAGAGAGGCGGAGGAGATCCGAGATGGCGGGGAGCGGGTGGAGGAGGATCCCGGC
GGTGAGGAGGCCGCCCATGTCGCGCCCGGCCTCGGTCTGCCTCTGGATCGTGCTCGTCGC
CGCCACCCTGGCGCTCGCCCAGGTGCTCATCCACCTCGCGAAGAAATCGAAGGCGGATTT
GACTGAGGTCACCCACAAGGTCTACTTCGACGTCGAGATTGATGGCAAGCCCGCAGGACG
GGTTGTCATGGGACTTTTCGGGAAGACTGTTCCTAAAACGGCAGAGAACTTCCGAGCACT
TTGCACAGGAGAGAAAGGAACTGGAAAGAGTGGCAAAGCACTCCACTTCAAGGGAAGTGC
ATTCCACAGAATTATACCCAGCTTTATGATCCAAGGAGGTGACTTCACACTTGGTGATGG
AAGGGGTGGTGAATCTATCTATGGGACGAAGTTCGCCGATGAAAACTTCAAGATCAAGCA
CACCGGACCAGGCCTCCTGTCCATGGCCAATGCTGGGAGAGACACAAACGGGTCCCAGTT
TTTCATCACCACTGTAACCACCAGCTGGTTGGACGGGAAGCACGTCGTGTTCGGTAAGGT
GCTGTCTGGAATGGATGTGGTTTACAAGATTGAAGCTGAGGGCCAGCAGAGTGGGTCACC
GAAGAGCAAAGTTGTCATCGCGGACAGCGGCGAACTGCCGATGTAATGAGCTGAAATGAT
GTTTCACTGAAGCTACTGCTACTGCTTCTCGTTGTAGAACTGTTATTAGCTGCTCTGTTT
TGCTATGCTTCTACCCCGAATCTGGTTGGAGTAAATTTCTGTTAGACTATAACAGCGTGC
TTATATCGCCTCTTAGTTGTGGGCGATTTGGAGTGAACTAGCATAAAAAGGTCGAAACTT
TACTT

CDS

678 bp

>Os06t0708500-01 Similar to Peptidyl-prolyl cis-trans isomerase.
ATGGCGGGGAGCGGGTGGAGGAGGATCCCGGCGGTGAGGAGGCCGCCCATGTCGCGCCCG
GCCTCGGTCTGCCTCTGGATCGTGCTCGTCGCCGCCACCCTGGCGCTCGCCCAGGTGCTC
ATCCACCTCGCGAAGAAATCGAAGGCGGATTTGACTGAGGTCACCCACAAGGTCTACTTC
GACGTCGAGATTGATGGCAAGCCCGCAGGACGGGTTGTCATGGGACTTTTCGGGAAGACT
GTTCCTAAAACGGCAGAGAACTTCCGAGCACTTTGCACAGGAGAGAAAGGAACTGGAAAG
AGTGGCAAAGCACTCCACTTCAAGGGAAGTGCATTCCACAGAATTATACCCAGCTTTATG
ATCCAAGGAGGTGACTTCACACTTGGTGATGGAAGGGGTGGTGAATCTATCTATGGGACG
AAGTTCGCCGATGAAAACTTCAAGATCAAGCACACCGGACCAGGCCTCCTGTCCATGGCC
AATGCTGGGAGAGACACAAACGGGTCCCAGTTTTTCATCACCACTGTAACCACCAGCTGG
TTGGACGGGAAGCACGTCGTGTTCGGTAAGGTGCTGTCTGGAATGGATGTGGTTTACAAG
ATTGAAGCTGAGGGCCAGCAGAGTGGGTCACCGAAGAGCAAAGTTGTCATCGCGGACAGC
GGCGAACTGCCGATGTAA

Protein

226 aa

>Os06t0708500-01 Similar to Peptidyl-prolyl cis-trans isomerase.
MAGSGWRRIPAVRRPPMSRPASVCLWIVLVAATLALAQVLIHLAKKSKADLTEVTHKVYF
DVEIDGKPAGRVVMGLFGKTVPKTAENFRALCTGEKGTGKSGKALHFKGSAFHRIIPSFM
IQGGDFTLGDGRGGESIYGTKFADENFKIKHTGPGLLSMANAGRDTNGSQFFITTVTTSW
LDGKHVVFGKVLSGMDVVYKIEAEGQQSGSPKSKVVIADSGELPM*

5'UTR

chr06:29973898..29973985 (+ strand) : 88 bp

CDS

chr06:29973986..29974114 (+ strand) : 129 bp

chr06:29974349..29974427 (+ strand) : 79 bp

chr06:29974824..29974871 (+ strand) : 48 bp

chr06:29974965..29974988 (+ strand) : 24 bp

chr06:29975455..29975637 (+ strand) : 183 bp

chr06:29975746..29975821 (+ strand) : 76 bp

chr06:29975921..29976059 (+ strand) : 139 bp

3'UTR

chr06:29976060..29976258 (+ strand) : 199 bp

FASTA

>Os06t0708500-01 class=Sequence position=chr06:29973898..29976258 (+ strand)
GTGGAGCAAC AGATCTATCC ATCCATCCCA TCCTCGATCC TTCATTCCTG CCCGGCGGCG AGCGAGAGAG AGGCGGAGGA
GATCCGAGAT GGCGGGGAGC GGGTGGAGGA GGATCCCGGC GGTGAGGAGG CCGCCCATGT CGCGCCCGGC CTCGGTCTGC
CTCTGGATCG TGCTCGTCGC CGCCACCCTG GCGCTCGCCC AGGTGCTCAT CCACCTCGTC CGTCTCCACT CTCCACCACG
CCTCGCTCCT CCTCCTGCTT CCCCGTATCT GCGTGTGATG TGATGCGTGT GCTCTCCGAT CTGATTCGAT TGTTTGTGCT
CGTGCGCTGA TTTCTTGATC TGTTTGATCT GTGGATCCAA TTGGCCCTGG TGTGCTGATT TGTTAGAATT TTGAGTGGTG
CCTCTATGTG CATCTATGCG TACTCACCTT TTTTTTTTTG TTGCTGTTTA GGCGAAGAAA TCGAAGGCGG ATTTGACTGA
GGTCACCCAC AAGGTCTACT TCGACGTCGA GATTGATGGC AAGCCCGCAG GTTTGTGTTG GCCCCCTATG TTTAGCTCTA
CTACCATATC AGCATAATAT ATAAGTCTTC AGGCAGAAAG AAGAAAAGAT ATGCATAGTT TGATGTGTCT AGCATTAGCA
AATACGGAGC AGTAACAATT TAATTTGCAT TAATTGTGTC CCACCGTTGT GTATAAGTGA CTTGTGATGG GCTGATGTCA
TATGCAGTGA TTATTACAGT TAGAGTTATC AGCATTTGAG ATTGACCTGA AGCTAACTCT ATTATGATGA GAATTTAGCT
TCTTCTATTG TTGTTTATGT TTAAGGAGAA ACGTTGATGT GATATTTGTG TATGTACTAT TTATAATGTC TTTCCTGTTA
ATGATTGCCT TACTGACATT TATTATTTTT TCTTGTATTG CCATAGGACG GGTTGTCATG GGACTTTTCG GGAAGACTGT
TCCTAAAACG GCAGGTACCA TTTGCTTATC ATTTAGTTAG GTAACAGGAA ATTCATTGTC ATATCACAAA TGCTAATGAT
TCACTATATC TTTTTTTTTT CCTACAGAGA ACTTCCGAGC ACTTTGCACA GGTATGCTCC CTGATGATTT ATACTGTTTT
TATTACATTA GATGTGTTCA TTCATCTTCT GCTAGAGTTT CCAGATGGTT AATCCCATGG CAAGCTTGGT AGTGGCAGCA
TGTAGAATTT CCAGCATTGA ATAACACTTT CTTTGCCACT TTAACCTGAA ATTATTTTTG AATGCACAAC TTTTGTGTCA
TTATCAAGTT TGGCCAATCA AATATACTGT TACAGTTGAC TAGTTAAAAA TTGATGCAAA AATACATCAG CTCAGCTGTT
GTCATTATTC ATACGCAAGT GTAGAATATT ATGAAAACCC ATAAAAGTAT TTACTTCATA TAATGAGAGA GATCCCATTC
TGGACAGCGA ATAGCACTAC AATCTGTGTG GTAGCATTCC CTGATGCCTA CTTGTGGTTA TTATACGTAA TCTAAGTTTG
GGTTTGATGT AGCGCTTTCA ACTTTGTTGT TATACAGGAG AGAAAGGAAC TGGAAAGAGT GGCAAAGCAC TCCACTTCAA
GGGAAGTGCA TTCCACAGAA TTATACCCAG CTTTATGATC CAAGGAGGTG ACTTCACACT TGGTGATGGA AGGGGTGGTG
AATCTATCTA TGGGACGAAG TTCGCCGATG AAAACTTCAA GATCAAGCAC ACCGGACCAG GTAATTTTCG TTATTTCCTG
AACCATTTTT TTACTACACT ATAGACGCAT TATTTGTGTG GTAGACCATC AAATCATCCT TGTTTGATTT GATCTCATGT
TTATGCAGGC CTCCTGTCCA TGGCCAATGC TGGGAGAGAC ACAAACGGGT CCCAGTTTTT CATCACCACT GTAACCACCA
GCTGGTAATC GTCGTTTCCT CACTAGCCTT TGTAATCATA GCAGCACTAT TTCTAATTTG TACTGAAGAC ACTTCAATCT
GTTGAAACTA TTTATTTGAT TAGGTTGGAC GGGAAGCACG TCGTGTTCGG TAAGGTGCTG TCTGGAATGG ATGTGGTTTA
CAAGATTGAA GCTGAGGGCC AGCAGAGTGG GTCACCGAAG AGCAAAGTTG TCATCGCGGA CAGCGGCGAA CTGCCGATGT
AATGAGCTGA AATGATGTTT CACTGAAGCT ACTGCTACTG CTTCTCGTTG TAGAACTGTT ATTAGCTGCT CTGTTTTGCT
ATGCTTCTAC CCCGAATCTG GTTGGAGTAA ATTTCTGTTA GACTATAACA GCGTGCTTAT ATCGCCTCTT AGTTGTGGGC
GATTTGGAGT GAACTAGCAT AAAAAGGTCG AAACTTTACT T

Locus: Os06g0708500

Loading...

Locus: Os06g0708500

Loading...