Os06t0708500-02

Locus

Os06g0708500

Description

Similar to Peptidyl-prolyl cis-trans isomerase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP20-1

CGSNL Gene Name

CYCLOPHILIN 20-1

Oryzabase Gene Symbol Synonym(s)

OsCYP20-1, OsCYP-17, OsCYP20-1a, OsCYP20-1b

Oryzabase Gene Name Synonym(s)

cyclophilin 20-1, cyclophilin 17

Transcript Evidence

AK072490 (DDBJ, Best hit)

Protein Evidence

A2YGV2 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type, conserved site (IPR020892)

Full-length cDNA

J023128K16 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0708500-02)

Others

Oryzabase (10060)

Transcript

1013 bp

>Os06t0708500-02 Similar to Peptidyl-prolyl cis-trans isomerase.
TGGAGCAACAGATCTATCCATCCATCCCATCCTCGATCCTTCATTCCTGCCCGGCGGCGA
GCGAGAGAGAGGCGGAGGAGATCCGAGATGGCGGGGAGCGGGTGGAGGAGGATCCCGGCG
GTGAGGAGGCCGCCCATGTCGCGCCCGGCCTCGGTCTGCCTCTGGATCGTGCTCGTCGCC
GCCACCCTGGCGCTCGCCCAGGCGAAGAAATCGAAGGCGGATTTGACTGAGGTCACCCAC
AAGGTCTACTTCGACGTCGAGATTGATGGCAAGCCCGCAGGACGGGTTGTCATGGGACTT
TTCGGGAAGACTGTTCCTAAAACGGCAGAGAACTTCCGAGCACTTTGCACAGGAGAGAAA
GGAACTGGAAAGAGTGGCAAAGCACTCCACTTCAAGGGAAGTGCATTCCACAGAATTATA
CCCAGCTTTATGATCCAAGGAGGTGACTTCACACTTGGTGATGGAAGGGGTGGTGAATCT
ATCTATGGGACGAAGTTCGCCGATGAAAACTTCAAGATCAAGCACACCGGACCAGGCCTC
CTGTCCATGGCCAATGCTGGGAGAGACACAAACGGGTCCCAGTTTTTCATCACCACTGTA
ACCACCAGCTGGTTGGACGGGAAGCACGTCGTGTTCGGTAAGGTGCTGTCTGGAATGGAT
GTGGTTTACAAGATTGAAGCTGAGGGCCAGCAGAGTGGGTCACCGAAGAGCAAAGTTGTC
ATCGCGGACAGCGGCGAACTGCCGATGTAATGAGCTGAAATGATGTTTCACTGAAGCTAC
TGCTACTGCTTCTCGTTGTAGAACTGTTATTAGCTGCTCTGTTTTGCTATGCTTCTACCC
CGAATCTGGTTGGAGTAAATTTCTGTTAGACTATAACAGCGTGCTTATATCGCCTCTTAG
TTGTGGGCGATTTGGAGTGAACTAGCATAAAAAGGTCGAAACTTTACTTAAGTCGTCTTC
TTGTTCTAAGTCGAATTATACTTTGAAGTGACTTGCTTACTGTTGAGCGCTTG

CDS

663 bp

>Os06t0708500-02 Similar to Peptidyl-prolyl cis-trans isomerase.
ATGGCGGGGAGCGGGTGGAGGAGGATCCCGGCGGTGAGGAGGCCGCCCATGTCGCGCCCG
GCCTCGGTCTGCCTCTGGATCGTGCTCGTCGCCGCCACCCTGGCGCTCGCCCAGGCGAAG
AAATCGAAGGCGGATTTGACTGAGGTCACCCACAAGGTCTACTTCGACGTCGAGATTGAT
GGCAAGCCCGCAGGACGGGTTGTCATGGGACTTTTCGGGAAGACTGTTCCTAAAACGGCA
GAGAACTTCCGAGCACTTTGCACAGGAGAGAAAGGAACTGGAAAGAGTGGCAAAGCACTC
CACTTCAAGGGAAGTGCATTCCACAGAATTATACCCAGCTTTATGATCCAAGGAGGTGAC
TTCACACTTGGTGATGGAAGGGGTGGTGAATCTATCTATGGGACGAAGTTCGCCGATGAA
AACTTCAAGATCAAGCACACCGGACCAGGCCTCCTGTCCATGGCCAATGCTGGGAGAGAC
ACAAACGGGTCCCAGTTTTTCATCACCACTGTAACCACCAGCTGGTTGGACGGGAAGCAC
GTCGTGTTCGGTAAGGTGCTGTCTGGAATGGATGTGGTTTACAAGATTGAAGCTGAGGGC
CAGCAGAGTGGGTCACCGAAGAGCAAAGTTGTCATCGCGGACAGCGGCGAACTGCCGATG
TAA

Protein

221 aa

>Os06t0708500-02 Similar to Peptidyl-prolyl cis-trans isomerase.
MAGSGWRRIPAVRRPPMSRPASVCLWIVLVAATLALAQAKKSKADLTEVTHKVYFDVEID
GKPAGRVVMGLFGKTVPKTAENFRALCTGEKGTGKSGKALHFKGSAFHRIIPSFMIQGGD
FTLGDGRGGESIYGTKFADENFKIKHTGPGLLSMANAGRDTNGSQFFITTVTTSWLDGKH
VVFGKVLSGMDVVYKIEAEGQQSGSPKSKVVIADSGELPM*

5'UTR

chr06:29973899..29973985 (+ strand) : 87 bp

CDS

chr06:29973986..29974099 (+ strand) : 114 bp

chr06:29974349..29974427 (+ strand) : 79 bp

chr06:29974824..29974871 (+ strand) : 48 bp

chr06:29974965..29974988 (+ strand) : 24 bp

chr06:29975455..29975637 (+ strand) : 183 bp

chr06:29975746..29975821 (+ strand) : 76 bp

chr06:29975921..29976059 (+ strand) : 139 bp

3'UTR

chr06:29976060..29976322 (+ strand) : 263 bp

FASTA

>Os06t0708500-02 class=Sequence position=chr06:29973899..29976322 (+ strand)
TGGAGCAACA GATCTATCCA TCCATCCCAT CCTCGATCCT TCATTCCTGC CCGGCGGCGA GCGAGAGAGA GGCGGAGGAG
ATCCGAGATG GCGGGGAGCG GGTGGAGGAG GATCCCGGCG GTGAGGAGGC CGCCCATGTC GCGCCCGGCC TCGGTCTGCC
TCTGGATCGT GCTCGTCGCC GCCACCCTGG CGCTCGCCCA GGTGCTCATC CACCTCGTCC GTCTCCACTC TCCACCACGC
CTCGCTCCTC CTCCTGCTTC CCCGTATCTG CGTGTGATGT GATGCGTGTG CTCTCCGATC TGATTCGATT GTTTGTGCTC
GTGCGCTGAT TTCTTGATCT GTTTGATCTG TGGATCCAAT TGGCCCTGGT GTGCTGATTT GTTAGAATTT TGAGTGGTGC
CTCTATGTGC ATCTATGCGT ACTCACCTTT TTTTTTTTGT TGCTGTTTAG GCGAAGAAAT CGAAGGCGGA TTTGACTGAG
GTCACCCACA AGGTCTACTT CGACGTCGAG ATTGATGGCA AGCCCGCAGG TTTGTGTTGG CCCCCTATGT TTAGCTCTAC
TACCATATCA GCATAATATA TAAGTCTTCA GGCAGAAAGA AGAAAAGATA TGCATAGTTT GATGTGTCTA GCATTAGCAA
ATACGGAGCA GTAACAATTT AATTTGCATT AATTGTGTCC CACCGTTGTG TATAAGTGAC TTGTGATGGG CTGATGTCAT
ATGCAGTGAT TATTACAGTT AGAGTTATCA GCATTTGAGA TTGACCTGAA GCTAACTCTA TTATGATGAG AATTTAGCTT
CTTCTATTGT TGTTTATGTT TAAGGAGAAA CGTTGATGTG ATATTTGTGT ATGTACTATT TATAATGTCT TTCCTGTTAA
TGATTGCCTT ACTGACATTT ATTATTTTTT CTTGTATTGC CATAGGACGG GTTGTCATGG GACTTTTCGG GAAGACTGTT
CCTAAAACGG CAGGTACCAT TTGCTTATCA TTTAGTTAGG TAACAGGAAA TTCATTGTCA TATCACAAAT GCTAATGATT
CACTATATCT TTTTTTTTTC CTACAGAGAA CTTCCGAGCA CTTTGCACAG GTATGCTCCC TGATGATTTA TACTGTTTTT
ATTACATTAG ATGTGTTCAT TCATCTTCTG CTAGAGTTTC CAGATGGTTA ATCCCATGGC AAGCTTGGTA GTGGCAGCAT
GTAGAATTTC CAGCATTGAA TAACACTTTC TTTGCCACTT TAACCTGAAA TTATTTTTGA ATGCACAACT TTTGTGTCAT
TATCAAGTTT GGCCAATCAA ATATACTGTT ACAGTTGACT AGTTAAAAAT TGATGCAAAA ATACATCAGC TCAGCTGTTG
TCATTATTCA TACGCAAGTG TAGAATATTA TGAAAACCCA TAAAAGTATT TACTTCATAT AATGAGAGAG ATCCCATTCT
GGACAGCGAA TAGCACTACA ATCTGTGTGG TAGCATTCCC TGATGCCTAC TTGTGGTTAT TATACGTAAT CTAAGTTTGG
GTTTGATGTA GCGCTTTCAA CTTTGTTGTT ATACAGGAGA GAAAGGAACT GGAAAGAGTG GCAAAGCACT CCACTTCAAG
GGAAGTGCAT TCCACAGAAT TATACCCAGC TTTATGATCC AAGGAGGTGA CTTCACACTT GGTGATGGAA GGGGTGGTGA
ATCTATCTAT GGGACGAAGT TCGCCGATGA AAACTTCAAG ATCAAGCACA CCGGACCAGG TAATTTTCGT TATTTCCTGA
ACCATTTTTT TACTACACTA TAGACGCATT ATTTGTGTGG TAGACCATCA AATCATCCTT GTTTGATTTG ATCTCATGTT
TATGCAGGCC TCCTGTCCAT GGCCAATGCT GGGAGAGACA CAAACGGGTC CCAGTTTTTC ATCACCACTG TAACCACCAG
CTGGTAATCG TCGTTTCCTC ACTAGCCTTT GTAATCATAG CAGCACTATT TCTAATTTGT ACTGAAGACA CTTCAATCTG
TTGAAACTAT TTATTTGATT AGGTTGGACG GGAAGCACGT CGTGTTCGGT AAGGTGCTGT CTGGAATGGA TGTGGTTTAC
AAGATTGAAG CTGAGGGCCA GCAGAGTGGG TCACCGAAGA GCAAAGTTGT CATCGCGGAC AGCGGCGAAC TGCCGATGTA
ATGAGCTGAA ATGATGTTTC ACTGAAGCTA CTGCTACTGC TTCTCGTTGT AGAACTGTTA TTAGCTGCTC TGTTTTGCTA
TGCTTCTACC CCGAATCTGG TTGGAGTAAA TTTCTGTTAG ACTATAACAG CGTGCTTATA TCGCCTCTTA GTTGTGGGCG
ATTTGGAGTG AACTAGCATA AAAAGGTCGA AACTTTACTT AAGTCGTCTT CTTGTTCTAA GTCGAATTAT ACTTTGAAGT
GACTTGCTTA CTGTTGAGCG CTTG

Locus: Os06g0708500

Loading...

Locus: Os06g0708500

Loading...