Os06t0714300-01

Locus

Os06g0714300

Description

Auxin responsive SAUR protein family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SAUR29

CGSNL Gene Name

SMALL AUXIN-UP RNA 29

Oryzabase Gene Symbol Synonym(s)

OsSAUR29

Oryzabase Gene Name Synonym(s)

Small auxin-up RNA 29

Transcript Evidence

AK107043 (DDBJ, Best hit)

Protein Evidence

XP_002318465.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Auxin responsive SAUR protein (IPR003676)

Full-length cDNA

002-121-C06 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0714300-01)

RiceXPro (AK107043)

Others

Oryzabase (9154)

KEGG (Os06t0714300-01)

Transcript

899 bp

>Os06t0714300-01 Auxin responsive SAUR protein family protein.
ACCAACTCCTCCTCGAGCCAAGAAACCATCAAGCTAGCGAGGCCACCTCACCGGCCGCCA
TGGAGATCCCGCCGCTCTAACGGCGGCGCGTTCTTGCTCGTCGTCGGAGCTAGAGATCGA
TCGACCAAGCTAGCGTTTCTTCGATTAGATATAGTCATATCTATATAGGTAGAAGGATGG
GTGTGCACTTGCTGAAGAGGCAGCAGTCATCGGCGTCGGCGGGGGGCTCGTCGGCGGGGG
GAGGGATGCCGCCGAAGGGGTGCATGGCGGTGAGGGTGGTGGGGCCCGGCGGCGTGGGCG
GCGGCGGAGGAGGAGCGGAGGGAGAGAGGTTCGTGGTGCCGGTGGGTTATCTGAAGCACC
CGCTGTTCGTGGGGCTCCTCAAGGAGGCCGAGGAGGAGTTCGGGTTCGAGCAGAAGGGCG
CCATCACCATCCCCTGCGGCGTCGACCACTTCCGCCGCGTCCAGGGCATCATCCACCACC
AGAAGCACCACCACGGCGGCTCCCATGGCGCCGGCGGCGCCGGCGCCGGCGGCCTCCTCT
CCGGCCACGGCTCGTCGGGACACCACAACAACTTCCACATCGCCGCCTGCTTCAGGGCCT
GATTGAGATGATCATCAGATGATGATGCATGGTGTTTCTTTGGCTAGCTTCTCTCTCTCT
TAGATCGATGGATTAATAATACTTAGGGTTTTAATTTCCTTTTGGTTAGGAATTTAGTCA
TGGTTTGTGATGATGATCAAAAAGGATCATGCATGCATGAGCAGATCTGTCATGCAGCTG
CGGGTTGTTCTCTGTTCATCCTTATAGGACTCTCTCTCTCTCTCTCTCTCTCTCTCCTAG
TTAAGTTAGATTGTGATGATGATGATGATGAAAATGGAGATCAAAGGATCTGTTCAATC

CDS

426 bp

>Os06t0714300-01 Auxin responsive SAUR protein family protein.
ATGGGTGTGCACTTGCTGAAGAGGCAGCAGTCATCGGCGTCGGCGGGGGGCTCGTCGGCG
GGGGGAGGGATGCCGCCGAAGGGGTGCATGGCGGTGAGGGTGGTGGGGCCCGGCGGCGTG
GGCGGCGGCGGAGGAGGAGCGGAGGGAGAGAGGTTCGTGGTGCCGGTGGGTTATCTGAAG
CACCCGCTGTTCGTGGGGCTCCTCAAGGAGGCCGAGGAGGAGTTCGGGTTCGAGCAGAAG
GGCGCCATCACCATCCCCTGCGGCGTCGACCACTTCCGCCGCGTCCAGGGCATCATCCAC
CACCAGAAGCACCACCACGGCGGCTCCCATGGCGCCGGCGGCGCCGGCGCCGGCGGCCTC
CTCTCCGGCCACGGCTCGTCGGGACACCACAACAACTTCCACATCGCCGCCTGCTTCAGG
GCCTGA

Protein

141 aa

>Os06t0714300-01 Auxin responsive SAUR protein family protein.
MGVHLLKRQQSSASAGGSSAGGGMPPKGCMAVRVVGPGGVGGGGGGAEGERFVVPVGYLK
HPLFVGLLKEAEEEFGFEQKGAITIPCGVDHFRRVQGIIHHQKHHHGGSHGAGGAGAGGL
LSGHGSSGHHNNFHIAACFRA*

5'UTR

chr06:30315493..30315668 (- strand) : 176 bp

CDS

chr06:30315067..30315492 (- strand) : 426 bp

3'UTR

chr06:30314770..30315066 (- strand) : 297 bp

FASTA

>Os06t0714300-01 class=Sequence position=chr06:30314770..30315668 (- strand)
ACCAACTCCT CCTCGAGCCA AGAAACCATC AAGCTAGCGA GGCCACCTCA CCGGCCGCCA TGGAGATCCC GCCGCTCTAA
CGGCGGCGCG TTCTTGCTCG TCGTCGGAGC TAGAGATCGA TCGACCAAGC TAGCGTTTCT TCGATTAGAT ATAGTCATAT
CTATATAGGT AGAAGGATGG GTGTGCACTT GCTGAAGAGG CAGCAGTCAT CGGCGTCGGC GGGGGGCTCG TCGGCGGGGG
GAGGGATGCC GCCGAAGGGG TGCATGGCGG TGAGGGTGGT GGGGCCCGGC GGCGTGGGCG GCGGCGGAGG AGGAGCGGAG
GGAGAGAGGT TCGTGGTGCC GGTGGGTTAT CTGAAGCACC CGCTGTTCGT GGGGCTCCTC AAGGAGGCCG AGGAGGAGTT
CGGGTTCGAG CAGAAGGGCG CCATCACCAT CCCCTGCGGC GTCGACCACT TCCGCCGCGT CCAGGGCATC ATCCACCACC
AGAAGCACCA CCACGGCGGC TCCCATGGCG CCGGCGGCGC CGGCGCCGGC GGCCTCCTCT CCGGCCACGG CTCGTCGGGA
CACCACAACA ACTTCCACAT CGCCGCCTGC TTCAGGGCCT GATTGAGATG ATCATCAGAT GATGATGCAT GGTGTTTCTT
TGGCTAGCTT CTCTCTCTCT TAGATCGATG GATTAATAAT ACTTAGGGTT TTAATTTCCT TTTGGTTAGG AATTTAGTCA
TGGTTTGTGA TGATGATCAA AAAGGATCAT GCATGCATGA GCAGATCTGT CATGCAGCTG CGGGTTGTTC TCTGTTCATC
CTTATAGGAC TCTCTCTCTC TCTCTCTCTC TCTCTCCTAG TTAAGTTAGA TTGTGATGAT GATGATGATG AAAATGGAGA
TCAAAGGATC TGTTCAATC

Locus: Os06g0714300

Loading...

Locus: Os06g0714300

Loading...