Os06t0715300-01

Locus

Os06g0715300

Description

Similar to CEL5=CELLULASE 5 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GH9B6

CGSNL Gene Name

GLYCOSIDE HYDROLASE 9B6

Oryzabase Gene Symbol Synonym(s)

OsGH9B6

Oryzabase Gene Name Synonym(s)

glycoside hydrolase OsGH9B6, glycoside hydrolase 9B6

Transcript Evidence

AK121369 (DDBJ, Best hit)

Protein Evidence

E7CQZ8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Functional domain (InterPro)

Glycoside hydrolase, family 9 (IPR001701)

Six-hairpin glycosidase-like (IPR008928)

Six-hairpin glycosidase (IPR012341)

Glycoside hydrolase, family 9, active site (IPR018221)

Full-length cDNA

J023125K15 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0715300-01)

RiceXPro (AK121369)

Others

Oryzabase (11706)

KEGG (Os06t0715300-01)

Transcript

2066 bp

>Os06t0715300-01 Similar to CEL5=CELLULASE 5 (Fragment).
GGTCGAGACGGTCATGGCGAGCCTCTAACTCCCCACCAACTGCCGCCTCTCGTCGCCTCG
CCTCGCCGGCGCCACCTCCGCATTCCGTTCCGACCAGCCGATCGGTTTCTTCCTCGCCGT
TGCAACCTTCGAGCGCGATCGATCGAGGCGGTTGACCGCCGATTCGCCGCGCGGCGTTGC
ATTGCACGCGGCTTTCCAGTTGATAAATCAATCATCATCCCCTTGATCGATGCGAGTGGC
GTTCTTGTTCGATCGAGAGGAGGAGATCGTGATCGCGAGCGATCCGGGCGGGGCGGCGCG
CCATCGATGGCGAACTGCGTGCGGTGCTGCTGCTGGCTCCTGGTGCTGATGCTCATGGCG
CTCGCGATCACCGCCGCCGTGGTGTTCGTCCGCTACAAGAACGGCGAGGGGGTCTTCCcc
ttccccggcgtgcccggcgccgtcgaccacaagtacgccgacgcgctcgccgtcgccctc
cagttcttccaggtccaGAAATCCGGGAAGCTGGTGAACAACACGATCCACTGGAGAGGT
GACTCGGCGCTGGACGACGGCAAGGAGGCCGGGATTGATCTCTCCAAGGGGATGTACGAC
GCCGGCGACCACATGAAGTTCGGATTCCCCATGGCGTTCACGGCCACCATGCTCTCTTGG
TCCGTCCTCGAGTACGGCGACGCCATGCGCGCCGCCGACCAGCGCGACTCCGCCATTGAC
GCGCTGAATTGGATCATGGATTACCTCGTCAATGCCCACCCCTCCGACGACGTCCTCTAC
ATCCAGGTGGGTGATCCTAAAGCAGACCACAAGTGCTGGGAGCGGCCGGAGAAGATGAAG
GAGAAGAGGCCACTGACCAAGATCACGCCCAAGTCCCCCGGCAGCGACGTGGCGGCGGAG
ACGGCGGCGGCCATGGCGGCGGCGTCGCTGGTGTACAAGACGATCAACAAGACGTACTCG
TCGTCGCTCCTGGACCACGGCGAGAGGCTGTTCGCCTTCGCCGACAAGCACCGGGGATCC
TACACCCGGACGTTCCCGGAGCTCAGCGCGTTCTACAACTCCACCACGTACCAGGACGAG
CTCCTCTGGGCGGCGAGCTGGCTCTACCACGCCACCGGCAACCACAGCTACCTCGCCTAC
GCCACCGGCAAGAACAAGGACTTCGCCGACCTGGGCAACCCGAGATACTTCAGCTGGGAC
GACAAGCGCGCCGGAACCGAGGTTCTTTTGTCGAGGGTGAGCTTCTTTGCTTCGCAAGGA
TCAGACGTTGCACAAGACGATGTTCTTGGGATGTACAAGCAGACTGCTGATGCCGTCATG
TGCATTCTCCTGCCGGATTCAGAGACCGCCGCTTTCAGAACAGAAGGTGGTTTGCTGTAC
GTTGCCGAGTGGAACTCACTCCAGCACCCGGTGGCATCGGCGTTCCTCGCCGCGGTTTAC
AGCGACTACATGCAGAGCTCCGGGAAGACGGAGCTGAGCTGCAGCGGGCAGGGCTTCTCG
CCGGCCGACCTGCGCAAATTCGCCAAGTCCCAGGCGGATTACTTGCTAGGCAGCAACCCG
ATGAAGATTAGTTACCTAGTCGGGTACGGCGACCGGTACCCGGAGAAGGTGCACCACCGC
GGCGCGTCCATCCCGGAGGACGTCGACACCGGCTGCGACGGCCACAAGTGGCTGGAGACG
TCCAAGCCCAACCCAAACGTCGCCACCGGCGCGCTCGTCGGCGGTCCGTACAAGAACGAC
AGCTTCGTCGACGAGCGCGACAACGTGATGCAGAACGAGGCCACCACCTACAACAGCGCC
CTCGTCGCCGGCTTGCTCTCCGCCCTCGTCTCCACCTCCTCCCTCGCGCGATCCTTGTCA
TGATCTGCATTGCTCGGATTCTGACGGTTTACCACTCATTAGATGGCATGCAAATGCTGG
CTCAAACTGATGAAGAAATGGTAGGGAGGATGTTGTATCATGGATCGAAGAAGTCGGTGA
TCTGTATGTGAAAAGGGTAATTAGTACTGTACTAGTACTTATACTTACTAACAAAAATAA
TCATTAGAAACTACTTTTGTTTGTTC

CDS

1557 bp

>Os06t0715300-01 Similar to CEL5=CELLULASE 5 (Fragment).
ATGGCGAACTGCGTGCGGTGCTGCTGCTGGCTCCTGGTGCTGATGCTCATGGCGCTCGCG
ATCACCGCCGCCGTGGTGTTCGTCCGCTACAAGAACGGCGAGGGGGTCTTCCccttcccc
ggcgtgcccggcgccgtcgaccacaagtacgccgacgcgctcgccgtcgccctccagttc
ttccaggtccaGAAATCCGGGAAGCTGGTGAACAACACGATCCACTGGAGAGGTGACTCG
GCGCTGGACGACGGCAAGGAGGCCGGGATTGATCTCTCCAAGGGGATGTACGACGCCGGC
GACCACATGAAGTTCGGATTCCCCATGGCGTTCACGGCCACCATGCTCTCTTGGTCCGTC
CTCGAGTACGGCGACGCCATGCGCGCCGCCGACCAGCGCGACTCCGCCATTGACGCGCTG
AATTGGATCATGGATTACCTCGTCAATGCCCACCCCTCCGACGACGTCCTCTACATCCAG
GTGGGTGATCCTAAAGCAGACCACAAGTGCTGGGAGCGGCCGGAGAAGATGAAGGAGAAG
AGGCCACTGACCAAGATCACGCCCAAGTCCCCCGGCAGCGACGTGGCGGCGGAGACGGCG
GCGGCCATGGCGGCGGCGTCGCTGGTGTACAAGACGATCAACAAGACGTACTCGTCGTCG
CTCCTGGACCACGGCGAGAGGCTGTTCGCCTTCGCCGACAAGCACCGGGGATCCTACACC
CGGACGTTCCCGGAGCTCAGCGCGTTCTACAACTCCACCACGTACCAGGACGAGCTCCTC
TGGGCGGCGAGCTGGCTCTACCACGCCACCGGCAACCACAGCTACCTCGCCTACGCCACC
GGCAAGAACAAGGACTTCGCCGACCTGGGCAACCCGAGATACTTCAGCTGGGACGACAAG
CGCGCCGGAACCGAGGTTCTTTTGTCGAGGGTGAGCTTCTTTGCTTCGCAAGGATCAGAC
GTTGCACAAGACGATGTTCTTGGGATGTACAAGCAGACTGCTGATGCCGTCATGTGCATT
CTCCTGCCGGATTCAGAGACCGCCGCTTTCAGAACAGAAGGTGGTTTGCTGTACGTTGCC
GAGTGGAACTCACTCCAGCACCCGGTGGCATCGGCGTTCCTCGCCGCGGTTTACAGCGAC
TACATGCAGAGCTCCGGGAAGACGGAGCTGAGCTGCAGCGGGCAGGGCTTCTCGCCGGCC
GACCTGCGCAAATTCGCCAAGTCCCAGGCGGATTACTTGCTAGGCAGCAACCCGATGAAG
ATTAGTTACCTAGTCGGGTACGGCGACCGGTACCCGGAGAAGGTGCACCACCGCGGCGCG
TCCATCCCGGAGGACGTCGACACCGGCTGCGACGGCCACAAGTGGCTGGAGACGTCCAAG
CCCAACCCAAACGTCGCCACCGGCGCGCTCGTCGGCGGTCCGTACAAGAACGACAGCTTC
GTCGACGAGCGCGACAACGTGATGCAGAACGAGGCCACCACCTACAACAGCGCCCTCGTC
GCCGGCTTGCTCTCCGCCCTCGTCTCCACCTCCTCCCTCGCGCGATCCTTGTCATGA

Protein

519 aa

>Os06t0715300-01 Similar to CEL5=CELLULASE 5 (Fragment).
MANCVRCCCWLLVLMLMALAITAAVVFVRYKNGEGVFPFPGVPGAVDHKYADALAVALQF
FQVQKSGKLVNNTIHWRGDSALDDGKEAGIDLSKGMYDAGDHMKFGFPMAFTATMLSWSV
LEYGDAMRAADQRDSAIDALNWIMDYLVNAHPSDDVLYIQVGDPKADHKCWERPEKMKEK
RPLTKITPKSPGSDVAAETAAAMAAASLVYKTINKTYSSSLLDHGERLFAFADKHRGSYT
RTFPELSAFYNSTTYQDELLWAASWLYHATGNHSYLAYATGKNKDFADLGNPRYFSWDDK
RAGTEVLLSRVSFFASQGSDVAQDDVLGMYKQTADAVMCILLPDSETAAFRTEGGLLYVA
EWNSLQHPVASAFLAAVYSDYMQSSGKTELSCSGQGFSPADLRKFAKSQADYLLGSNPMK
ISYLVGYGDRYPEKVHHRGASIPEDVDTGCDGHKWLETSKPNPNVATGALVGGPYKNDSF
VDERDNVMQNEATTYNSALVAGLLSALVSTSSLARSLS*

5'UTR

chr06:30366357..30366662 (- strand) : 306 bp

CDS

chr06:30366161..30366356 (- strand) : 196 bp

chr06:30365797..30366080 (- strand) : 284 bp

chr06:30365281..30365715 (- strand) : 435 bp

chr06:30365021..30365165 (- strand) : 145 bp

chr06:30364733..30364899 (- strand) : 167 bp

chr06:30364257..30364586 (- strand) : 330 bp

3'UTR

chr06:30364054..30364256 (- strand) : 203 bp

FASTA

>Os06t0715300-01 class=Sequence position=chr06:30364054..30366662 (- strand)
GGTCGAGACG GTCATGGCGA GCCTCTAACT CCCCACCAAC TGCCGCCTCT CGTCGCCTCG CCTCGCCGGC GCCACCTCCG
CATTCCGTTC CGACCAGCCG ATCGGTTTCT TCCTCGCCGT TGCAACCTTC GAGCGCGATC GATCGAGGCG GTTGACCGCC
GATTCGCCGC GCGGCGTTGC ATTGCACGCG GCTTTCCAGT TGATAAATCA ATCATCATCC CCTTGATCGA TGCGAGTGGC
GTTCTTGTTC GATCGAGAGG AGGAGATCGT GATCGCGAGC GATCCGGGCG GGGCGGCGCG CCATCGATGG CGAACTGCGT
GCGGTGCTGC TGCTGGCTCC TGGTGCTGAT GCTCATGGCG CTCGCGATCA CCGCCGCCGT GGTGTTCGTC CGCTACAAGA
ACGGCGAGGG GGTCTTCCcc ttccccggcg tgcccggcgc cgtcgaccac aagtacgccg acgcgctcgc cgtcgccctc
cagttcttcc aggtccaGAA ATGTAAGGAA TTATTCTCAA CTTTGCATGC ATTTTTTTTT TTTGCGTTTG ATCTCGATCA
TGGAAGTTCT TGATCGATGA AGCCGGGAAG CTGGTGAACA ACACGATCCA CTGGAGAGGT GACTCGGCGC TGGACGACGG
CAAGGAGGCC GGGATTGATC TCTCCAAGGG GATGTACGAC GCCGGCGACC ACATGAAGTT CGGATTCCCC ATGGCGTTCA
CGGCCACCAT GCTCTCTTGG TCCGTCCTCG AGTACGGCGA CGCCATGCGC GCCGCCGACC AGCGCGACTC CGCCATTGAC
GCGCTGAATT GGATCATGGA TTACCTCGTC AATGCCCACC CCTCCGACGA CGTCCTCTAC ATCCAGGTGA TCATCATCAA
ATGATCGAAT AATCTTTATC CAATTCTTGG GAAATCAATT AATTTCTTCT GGCATTCTGA TCTCCAGGTG GGTGATCCTA
AAGCAGACCA CAAGTGCTGG GAGCGGCCGG AGAAGATGAA GGAGAAGAGG CCACTGACCA AGATCACGCC CAAGTCCCCC
GGCAGCGACG TGGCGGCGGA GACGGCGGCG GCCATGGCGG CGGCGTCGCT GGTGTACAAG ACGATCAACA AGACGTACTC
GTCGTCGCTC CTGGACCACG GCGAGAGGCT GTTCGCCTTC GCCGACAAGC ACCGGGGATC CTACACCCGG ACGTTCCCGG
AGCTCAGCGC GTTCTACAAC TCCACCACGT ACCAGGACGA GCTCCTCTGG GCGGCGAGCT GGCTCTACCA CGCCACCGGC
AACCACAGCT ACCTCGCCTA CGCCACCGGC AAGAACAAGG ACTTCGCCGA CCTGGGCAAC CCGAGATACT TCAGCTGGGA
CGACAAGCGC GCCGGAACCG AGGTGGGTGA TAATGACCGT GACACCGCCA CTGATTCAAC TCCACTGTTC ATGGCAAATT
TTGAAATCTT GGGATGGTTA TGAAGTGAAT TTTTGTGGTG TTTTGTTTGA GTTTCAGGTT CTTTTGTCGA GGGTGAGCTT
CTTTGCTTCG CAAGGATCAG ACGTTGCACA AGACGATGTT CTTGGGATGT ACAAGCAGAC TGCTGATGCC GTCATGTGCA
TTCTCCTGCC GGATTCAGAG ACCGCCGCTT TCAGAACAGA AGGTAAATAT TCACAAGATT CAGAAGCAAA AATAAAAAAA
GCAATCTCAG GTTCACCATT TGTGTAGCTG GTAATAATAA TAATCCAGTA GTATTTCAGA TAGCTTGCAA CGATTTATTT
CAGGTGGTTT GCTGTACGTT GCCGAGTGGA ACTCACTCCA GCACCCGGTG GCATCGGCGT TCCTCGCCGC GGTTTACAGC
GACTACATGC AGAGCTCCGG GAAGACGGAG CTGAGCTGCA GCGGGCAGGG CTTCTCGCCG GCCGACCTGC GCAAATTCGC
CAAGTCCCAG GTAGTAACAA GATTCAGAAT CATCCATGAA CCAGAGTTCA CAATTGTTCA GACTAACATA TGTTCAGAGA
GAACAGAAAT GTTCAGAAAT ACAGTACGTA ACTTGGATGT GATCACGCAC TGATCAGTGA TCTTTGTTCT TGGCAGGCGG
ATTACTTGCT AGGCAGCAAC CCGATGAAGA TTAGTTACCT AGTCGGGTAC GGCGACCGGT ACCCGGAGAA GGTGCACCAC
CGCGGCGCGT CCATCCCGGA GGACGTCGAC ACCGGCTGCG ACGGCCACAA GTGGCTGGAG ACGTCCAAGC CCAACCCAAA
CGTCGCCACC GGCGCGCTCG TCGGCGGTCC GTACAAGAAC GACAGCTTCG TCGACGAGCG CGACAACGTG ATGCAGAACG
AGGCCACCAC CTACAACAGC GCCCTCGTCG CCGGCTTGCT CTCCGCCCTC GTCTCCACCT CCTCCCTCGC GCGATCCTTG
TCATGATCTG CATTGCTCGG ATTCTGACGG TTTACCACTC ATTAGATGGC ATGCAAATGC TGGCTCAAAC TGATGAAGAA
ATGGTAGGGA GGATGTTGTA TCATGGATCG AAGAAGTCGG TGATCTGTAT GTGAAAAGGG TAATTAGTAC TGTACTAGTA
CTTATACTTA CTAACAAAAA TAATCATTAG AAACTACTTT TGTTTGTTC