Os06t0724500-01

Locus

Os06g0724500

Description

WD40 repeat-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsWD40-135

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK068831 (DDBJ, Best hit)

Protein Evidence

NP_001167678.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

WD40 repeat (IPR001680)

WD40 repeat-like-containing domain (IPR011046)

WD40/YVTN repeat-like-containing domain (IPR015943)

WD40-repeat-containing domain (IPR017986)

WD40 repeat, subgroup (IPR019781)

WD40 repeat 2 (IPR019782)

Full-length cDNA

J013158G13 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0724500-01)

RiceXPro (AK068831)

Others

Oryzabase (10816)

KEGG (Os06t0724500-01)

Transcript

1723 bp

>Os06t0724500-01 WD40 repeat-like domain containing protein.
AGAAGGCCTCGCGGCGGAGGAGGAAGAAGGAAGAAGAAGGCGAGGCGATGCCGCGGGAGG
GGACGCGGATGGCGGGGCTGTGGGAGCGCGAGGTCGGCTGCCTCCCGCCCAAGCTCTTCG
CCAACTCCGTCATGGCCTCCCAGGACTTTGTGCGGTCTCTCGGTGTCCAGAAGAGGCTGC
GGAAGCACAGGGGCTGTGTGAATACCATCAGCTTTAACGAGGATGGGAGCTTGCTCCTGT
CCGGTTCGGACGATCGGGCCGCTGTACTGTGGAATTGGCAAGAGGGGACGCCTACCTTCG
CGTTCCACACTGGCCACAGCGACAATGTGTTCCATGCTCTGTTCATGCCCTTCTCAGGTG
ACCGGAGCATCATCACATGCGCTGCTGATGGACAGGTGAGGCATTCGCAAATACAAGAAG
GTGGTCGTGTAATTACAAATGAGCTAGTTGATACAGAGGTAGCAGTGCACAAACTAGCTA
TTGAGCCTGGAAATCCTCACACATTCTTTAGCTGCGGAGATAATGGCTCCGTTTTTCTTT
TTGACCTAAGGGAGAAATATGTTGCTGAACTCTTTAAATGCGCAGAAGTTGATCATTTTG
GTGGTGATACCATTGAACTCTATGCTATTGCCATAGACCCGAGAAAGCCTAGTTGTTTTG
CAGTTGCTGGATCTGATGAGTATGTGAGAATATATGATAGCCGCAAGATTGATGTGAATG
GGAATTCTAGTTTTGGTCGGCCAATTGAATACTTTTGCCCTCCACATATGATGGGCGAAA
ACAAAGATGGAATATCTGGTTTGGCATTCTCGCAGACCAGCGAACTATTGGCATCCTATA
GTTATGATAACATCTACCTTTTCTCGAGAGAACATGGCTTACACTTCAACAATATTGAGG
TAGGAAAACGACTCCTGATGGATGAGATTGAAGGAGACTGCCATATAAATACAGCTCCAT
TACCCTTTTGTAGAGATAAGTTGCCTGCACCTCAAATATTCAAGGGACATCGTAACAAGC
ACACCATGAAGGGTGTTAATTTCCTTGGGCCCAACTGTGACTATGTTACCACTGGATCAG
ACTGTGGCCGTGTATTTATTTGGAGGAAGAAGGATGGGGAGCTTATGCGGGTTATGAAAG
GGGATAAACAGATTGTGAACTGTGTTGAGCAGCACCCTTATGGGATTGTTATTGCAAACT
GTGGCATTGATAAAGATATCAAGATTTGGGCTCCTGGTGGAAGTGAGAACCCTGACGAGG
TTGAGACAGATTCTTGTTGCTCTGATATCAGTGAGTCCTATGACTCGGTTTACTTTGATG
ATTACATATTTTCCTCGGATTTTGATTCATCTGAAGAGGACGACGAAGACGACGACGACG
ATGATGATGATGATGACGATGACGAAGAAGATGGCCTTAGTGTTAGTATCAACGAAGACA
TGAGCTATGAAGAGAAAGATGCAGCCAGCGACCATGACAGCGATGTTTAAAGGTTGCATT
CAGCTATTATGAGACCGTAGGATGGTTCAGTCTTAGAACATGGTCAGTTAGGGGATCATC
GACAGTTTTGTATGATGTATGCCTTAGGTTGTTTTATCATGTGTTCCTTTCTCAGTCCTC
GGCCGTATTGCTTGTACATACATATACATATGCCTGAGATAGCTAAGCAAAAGCATACTT
ACATGTGGACAAATTTGAGTGGATGGAGAATTTTGTGTATATT

CDS

1443 bp

>Os06t0724500-01 WD40 repeat-like domain containing protein.
ATGCCGCGGGAGGGGACGCGGATGGCGGGGCTGTGGGAGCGCGAGGTCGGCTGCCTCCCG
CCCAAGCTCTTCGCCAACTCCGTCATGGCCTCCCAGGACTTTGTGCGGTCTCTCGGTGTC
CAGAAGAGGCTGCGGAAGCACAGGGGCTGTGTGAATACCATCAGCTTTAACGAGGATGGG
AGCTTGCTCCTGTCCGGTTCGGACGATCGGGCCGCTGTACTGTGGAATTGGCAAGAGGGG
ACGCCTACCTTCGCGTTCCACACTGGCCACAGCGACAATGTGTTCCATGCTCTGTTCATG
CCCTTCTCAGGTGACCGGAGCATCATCACATGCGCTGCTGATGGACAGGTGAGGCATTCG
CAAATACAAGAAGGTGGTCGTGTAATTACAAATGAGCTAGTTGATACAGAGGTAGCAGTG
CACAAACTAGCTATTGAGCCTGGAAATCCTCACACATTCTTTAGCTGCGGAGATAATGGC
TCCGTTTTTCTTTTTGACCTAAGGGAGAAATATGTTGCTGAACTCTTTAAATGCGCAGAA
GTTGATCATTTTGGTGGTGATACCATTGAACTCTATGCTATTGCCATAGACCCGAGAAAG
CCTAGTTGTTTTGCAGTTGCTGGATCTGATGAGTATGTGAGAATATATGATAGCCGCAAG
ATTGATGTGAATGGGAATTCTAGTTTTGGTCGGCCAATTGAATACTTTTGCCCTCCACAT
ATGATGGGCGAAAACAAAGATGGAATATCTGGTTTGGCATTCTCGCAGACCAGCGAACTA
TTGGCATCCTATAGTTATGATAACATCTACCTTTTCTCGAGAGAACATGGCTTACACTTC
AACAATATTGAGGTAGGAAAACGACTCCTGATGGATGAGATTGAAGGAGACTGCCATATA
AATACAGCTCCATTACCCTTTTGTAGAGATAAGTTGCCTGCACCTCAAATATTCAAGGGA
CATCGTAACAAGCACACCATGAAGGGTGTTAATTTCCTTGGGCCCAACTGTGACTATGTT
ACCACTGGATCAGACTGTGGCCGTGTATTTATTTGGAGGAAGAAGGATGGGGAGCTTATG
CGGGTTATGAAAGGGGATAAACAGATTGTGAACTGTGTTGAGCAGCACCCTTATGGGATT
GTTATTGCAAACTGTGGCATTGATAAAGATATCAAGATTTGGGCTCCTGGTGGAAGTGAG
AACCCTGACGAGGTTGAGACAGATTCTTGTTGCTCTGATATCAGTGAGTCCTATGACTCG
GTTTACTTTGATGATTACATATTTTCCTCGGATTTTGATTCATCTGAAGAGGACGACGAA
GACGACGACGACGATGATGATGATGATGACGATGACGAAGAAGATGGCCTTAGTGTTAGT
ATCAACGAAGACATGAGCTATGAAGAGAAAGATGCAGCCAGCGACCATGACAGCGATGTT
TAA

Protein

481 aa

>Os06t0724500-01 WD40 repeat-like domain containing protein.
MPREGTRMAGLWEREVGCLPPKLFANSVMASQDFVRSLGVQKRLRKHRGCVNTISFNEDG
SLLLSGSDDRAAVLWNWQEGTPTFAFHTGHSDNVFHALFMPFSGDRSIITCAADGQVRHS
QIQEGGRVITNELVDTEVAVHKLAIEPGNPHTFFSCGDNGSVFLFDLREKYVAELFKCAE
VDHFGGDTIELYAIAIDPRKPSCFAVAGSDEYVRIYDSRKIDVNGNSSFGRPIEYFCPPH
MMGENKDGISGLAFSQTSELLASYSYDNIYLFSREHGLHFNNIEVGKRLLMDEIEGDCHI
NTAPLPFCRDKLPAPQIFKGHRNKHTMKGVNFLGPNCDYVTTGSDCGRVFIWRKKDGELM
RVMKGDKQIVNCVEQHPYGIVIANCGIDKDIKIWAPGGSENPDEVETDSCCSDISESYDS
VYFDDYIFSSDFDSSEEDDEDDDDDDDDDDDDEEDGLSVSINEDMSYEEKDAASDHDSDV
*

5'UTR

chr06:30779539..30779585 (- strand) : 47 bp

CDS

chr06:30779443..30779538 (- strand) : 96 bp

chr06:30778854..30779105 (- strand) : 252 bp

chr06:30778601..30778744 (- strand) : 144 bp

chr06:30777797..30778516 (- strand) : 720 bp

chr06:30777141..30777371 (- strand) : 231 bp

3'UTR

chr06:30776908..30777140 (- strand) : 233 bp

FASTA

>Os06t0724500-01 class=Sequence position=chr06:30776908..30779585 (- strand)
AGAAGGCCTC GCGGCGGAGG AGGAAGAAGG AAGAAGAAGG CGAGGCGATG CCGCGGGAGG GGACGCGGAT GGCGGGGCTG
TGGGAGCGCG AGGTCGGCTG CCTCCCGCCC AAGCTCTTCG CCAACTCCGT CATGGCCTCC CAGGTCAGGT CCAATCCAAC
CCTCTCTCTC TAGTTTCTTC CCCATCCCTT TTGCTCTTCC GCACGGAGAC CAAATCACCA CCCAGCGCTC GCTTTTCTGT
TTCCTCCAGC GTTTTAATCC TAAAATCGAA CAGCATTAGG TTACGTTAGA ACAGGATTAA CTGTATCCTA CCGTGGAAAT
CGGTGCGTTC ATTAAGAGAA ACCAACTTAG TACTAGGTTC AGAGAGCACA GTCAACGCAA CAAAGGAGGT TCAGAGAGAA
TCACAGGTGG TTGTTGCAGT AGCCTTGTGA TGGCTTCTTT TGTTTCTATA ACCATGGAGC ATGTTTGACT GTTTGTGCAG
GACTTTGTGC GGTCTCTCGG TGTCCAGAAG AGGCTGCGGA AGCACAGGGG CTGTGTGAAT ACCATCAGCT TTAACGAGGA
TGGGAGCTTG CTCCTGTCCG GTTCGGACGA TCGGGCCGCT GTACTGTGGA ATTGGCAAGA GGGGACGCCT ACCTTCGCGT
TCCACACTGG CCACAGCGAC AATGTGTTCC ATGCTCTGTT CATGCCCTTC TCAGGTGACC GGAGCATCAT CACATGCGCT
GCTGATGGAC AGGTATATAT ATATATTGGC TCAGAGTCAT CCAATTTTAT TTTTACCATG TTTTCACCAT TCTCCTCTAC
ATCGTACACA TGGTCACATG TTTGCTGTTT CCGTGAAACA GGTGAGGCAT TCGCAAATAC AAGAAGGTGG TCGTGTAATT
ACAAATGAGC TAGTTGATAC AGAGGTAGCA GTGCACAAAC TAGCTATTGA GCCTGGAAAT CCTCACACAT TCTTTAGCTG
CGGAGATAAT GGCTCCGTTT TTCTTGTAAG TTGTTAAACT TGCTAACTTC ATTCACCTGT AATAATATCT GCTTGGGTTC
CTTTGTTGAT AACTCTCTGT TTGATCCAGT TTGACCTAAG GGAGAAATAT GTTGCTGAAC TCTTTAAATG CGCAGAAGTT
GATCATTTTG GTGGTGATAC CATTGAACTC TATGCTATTG CCATAGACCC GAGAAAGCCT AGTTGTTTTG CAGTTGCTGG
ATCTGATGAG TATGTGAGAA TATATGATAG CCGCAAGATT GATGTGAATG GGAATTCTAG TTTTGGTCGG CCAATTGAAT
ACTTTTGCCC TCCACATATG ATGGGCGAAA ACAAAGATGG AATATCTGGT TTGGCATTCT CGCAGACCAG CGAACTATTG
GCATCCTATA GTTATGATAA CATCTACCTT TTCTCGAGAG AACATGGCTT ACACTTCAAC AATATTGAGG TAGGAAAACG
ACTCCTGATG GATGAGATTG AAGGAGACTG CCATATAAAT ACAGCTCCAT TACCCTTTTG TAGAGATAAG TTGCCTGCAC
CTCAAATATT CAAGGGACAT CGTAACAAGC ACACCATGAA GGGTGTTAAT TTCCTTGGGC CCAACTGTGA CTATGTTACC
ACTGGATCAG ACTGTGGCCG TGTATTTATT TGGAGGAAGA AGGATGGGGA GCTTATGCGG GTTATGAAAG GGGATAAACA
GATTGTGAAC TGTGTTGAGC AGCACCCTTA TGGGATTGTT ATTGCAAACT GTGGCATTGA TAAAGATATC AAGATTTGGG
CTCCTGGTGG AAGTGAGAAC CCTGACGAGG TATAATCTTT ATTTTGTGCA AACTTATTGT GCTTCTCCTG ATGTTTTATG
CTCATTACTT GCTAAACTTA TCAGGCATGG CATAAATATG TTGGGCCGCC ATGGTTTATA CATGGCATCC GAATTAATGT
TCTTGAGATG TGCTTATTAA CTTTTTGCAT GAAGCTAGGG TGTGAATGTT AGCTGACTTG ATTCATATAG TATTTTTTAT
ATGTAAAATC ACCATTATGA ATCTGAGGTA CCAGGAAATG AGAAAAAAAA AAGAGGACCA AATTTGCAGG CTTGTAGAAA
GTAGCTCTAT CTGTATGTTT TGTACTGCTG CATCAATGAT ATTAGAATTA TGATATATGC GATATCACAT AATGTTTTCT
ACCGGTGCAT AAACGAAATT AGTGTTCTGA TGTATGCGGT ACTATGGTTT GCAGGTTGAG ACAGATTCTT GTTGCTCTGA
TATCAGTGAG TCCTATGACT CGGTTTACTT TGATGATTAC ATATTTTCCT CGGATTTTGA TTCATCTGAA GAGGACGACG
AAGACGACGA CGACGATGAT GATGATGATG ACGATGACGA AGAAGATGGC CTTAGTGTTA GTATCAACGA AGACATGAGC
TATGAAGAGA AAGATGCAGC CAGCGACCAT GACAGCGATG TTTAAAGGTT GCATTCAGCT ATTATGAGAC CGTAGGATGG
TTCAGTCTTA GAACATGGTC AGTTAGGGGA TCATCGACAG TTTTGTATGA TGTATGCCTT AGGTTGTTTT ATCATGTGTT
CCTTTCTCAG TCCTCGGCCG TATTGCTTGT ACATACATAT ACATATGCCT GAGATAGCTA AGCAAAAGCA TACTTACATG
TGGACAAATT TGAGTGGATG GAGAATTTTG TGTATATT