Os06t0726200-02

Locus

Os06g0726200

Description

Similar to Chitinase 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CHT1

CGSNL Gene Name

CHITINASE 1

Oryzabase Gene Symbol Synonym(s)

Cht1*(Chi1), Ch16, Cht1, CHT-1, CH16, RC24, OsChia1a, OsChia1, Chi1, Cht1*, Chi-1, Cht-1, Cht1, RCC1, OsCht-1

Oryzabase Gene Name Synonym(s)

Chitinase1, Chitinase 1, Pathogenesis related (PR)-3 chitinase 1, Class I chitinase a, Chitinase-1(class I)

Transcript Evidence

AK061042 (DDBJ, Best hit)

AK099339 (DDBJ, Best hit)

AK104020 (DDBJ, Best hit)

AK105798 (DDBJ, Best hit)

Protein Evidence

Q42993 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Biological Process: chitin catabolic process (GO:0006032)

Biological Process: cell wall macromolecule catabolic process (GO:0016998)

Molecular Function: chitinase activity (GO:0004568)

Molecular Function: chitin binding (GO:0008061)

Functional domain (InterPro)

Glycoside hydrolase, family 19, catalytic (IPR000726)

Chitin-binding, type 1 (IPR001002)

Glycoside hydrolase, family 19 (IPR016283)

Chitin-binding, type 1, conserved site (IPR018371)

Lysozyme-like domain (IPR023346)

Full-length cDNA

006-205-D05 (Online Clone Ordering)

J033028I21 (Online Clone Ordering)

001-008-C04 (Online Clone Ordering)

001-203-A08 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0726200-02)

Others

Oryzabase (694)

Transcript

1217 bp

>Os06t0726200-02 Similar to Chitinase 1.
ATCACTGCAACTCAGCAGCAAGCAAGCTAACTCCATTTTGCTTTGCATTGCCACCATGAG
AGCGCTCGCCGTGGTCGTGGTGGCCACGGCCTTTGCGGTGGTGGCCGTGCGCGGCGAGCA
GTGCGGCAGCCAGGCCGGCGGCGCGCTCTGCCCCAACTGCCTCTGCTGCAGCCAGTACGG
CTGGTGCGGATCCACCTCCGCCTACTGCGGCTCCGGCTGCCAGAGCCAGTGCTCCGGCAG
CTGCGGCGGCGGCGGCCCGACCCCGCCCTCCGGCGGTGGCGGCAGCGGCGTCGCCTCCAT
CGTGTCGCGCTCGCTCTTCGACCAGATGCTTCTCCACCGCAACGACGCGGCGTGCCCGGC
CAAGAACTTCTACACCTACGACGCCTTCGTCGCCGCCGCCAACGCCTTCCCGAGCTTCGC
CACAACCGGCGACGCCGCCACCCGCAAGCGCGAGGTCGCCGCGTTCCTGGCGCAGACGTC
GCACGAGACCACGGGCGGGTGGGCGACGGCGCCCGATGGCCCCTACTCGTGGGGCTACTG
CTTCAAGGAGGAGAACAACGGCAACGTTGGGTCCGACTACTGTGTCCAGAGCTCGCAGTG
GCCGTGCGCCGCCGGCAAGAAGTACTACGGCCGGGGACCCATCCAGATCTCCTACAACTA
CAACTACGGCCCGGCGGGGCAGGCCATCGGCTCCAACCTGCTGAGCAACCCGGACCTGGT
GGCGTCGGACGCCACCGTCTCCTTCAAGACGGCGTTCTGGTTCTGGATGACGCCGCAGTC
GCCCAAGCCGTCGTGCCACGCGGTGATGACAGGGCAGTGGACGCCCAACGGCAACGACCA
GGCGGCGGGGCGCGTGCCGGGCTACGGCGTGGTGACCAACATCATCAACGGCGGCGTGGA
GTGCGGCCACGGCGCGGACAGCAGAGTCGCCGACCGGATTGGGTTCTACAAGCGCTACTG
CGACATGTTGGGCGTCAGCTACGGCGCCAACTTGGACTGCTACAACCAGAGGCCTTTCAA
CTCCTAATAGCTCGTTCTAGCTTCAAGCTTTGCACTGATAACCACTGATCGGATGCTTTA
CATCGATGAATAAGAATTCATCCGAGCAGACAAATAATACAATCATCAGTAATGCCCACA
ATGGCTGATGGAAAATATATTGTGCTTCCGATTATTAATAATTAATACTTCTACATAATA
AACAAGATACGCTCTCC

CDS

972 bp

>Os06t0726200-02 Similar to Chitinase 1.
ATGAGAGCGCTCGCCGTGGTCGTGGTGGCCACGGCCTTTGCGGTGGTGGCCGTGCGCGGC
GAGCAGTGCGGCAGCCAGGCCGGCGGCGCGCTCTGCCCCAACTGCCTCTGCTGCAGCCAG
TACGGCTGGTGCGGATCCACCTCCGCCTACTGCGGCTCCGGCTGCCAGAGCCAGTGCTCC
GGCAGCTGCGGCGGCGGCGGCCCGACCCCGCCCTCCGGCGGTGGCGGCAGCGGCGTCGCC
TCCATCGTGTCGCGCTCGCTCTTCGACCAGATGCTTCTCCACCGCAACGACGCGGCGTGC
CCGGCCAAGAACTTCTACACCTACGACGCCTTCGTCGCCGCCGCCAACGCCTTCCCGAGC
TTCGCCACAACCGGCGACGCCGCCACCCGCAAGCGCGAGGTCGCCGCGTTCCTGGCGCAG
ACGTCGCACGAGACCACGGGCGGGTGGGCGACGGCGCCCGATGGCCCCTACTCGTGGGGC
TACTGCTTCAAGGAGGAGAACAACGGCAACGTTGGGTCCGACTACTGTGTCCAGAGCTCG
CAGTGGCCGTGCGCCGCCGGCAAGAAGTACTACGGCCGGGGACCCATCCAGATCTCCTAC
AACTACAACTACGGCCCGGCGGGGCAGGCCATCGGCTCCAACCTGCTGAGCAACCCGGAC
CTGGTGGCGTCGGACGCCACCGTCTCCTTCAAGACGGCGTTCTGGTTCTGGATGACGCCG
CAGTCGCCCAAGCCGTCGTGCCACGCGGTGATGACAGGGCAGTGGACGCCCAACGGCAAC
GACCAGGCGGCGGGGCGCGTGCCGGGCTACGGCGTGGTGACCAACATCATCAACGGCGGC
GTGGAGTGCGGCCACGGCGCGGACAGCAGAGTCGCCGACCGGATTGGGTTCTACAAGCGC
TACTGCGACATGTTGGGCGTCAGCTACGGCGCCAACTTGGACTGCTACAACCAGAGGCCT
TTCAACTCCTAA

Protein

324 aa

>Os06t0726200-02 Similar to Chitinase 1.
MRALAVVVVATAFAVVAVRGEQCGSQAGGALCPNCLCCSQYGWCGSTSAYCGSGCQSQCS
GSCGGGGPTPPSGGGGSGVASIVSRSLFDQMLLHRNDAACPAKNFYTYDAFVAAANAFPS
FATTGDAATRKREVAAFLAQTSHETTGGWATAPDGPYSWGYCFKEENNGNVGSDYCVQSS
QWPCAAGKKYYGRGPIQISYNYNYGPAGQAIGSNLLSNPDLVASDATVSFKTAFWFWMTP
QSPKPSCHAVMTGQWTPNGNDQAAGRVPGYGVVTNIINGGVECGHGADSRVADRIGFYKR
YCDMLGVSYGANLDCYNQRPFNS*

5'UTR

chr06:30890834..30890888 (+ strand) : 55 bp

CDS

chr06:30890889..30891860 (+ strand) : 972 bp

3'UTR

chr06:30891861..30892050 (+ strand) : 190 bp

FASTA

>Os06t0726200-02 class=Sequence position=chr06:30890834..30892050 (+ strand)
ATCACTGCAA CTCAGCAGCA AGCAAGCTAA CTCCATTTTG CTTTGCATTG CCACCATGAG AGCGCTCGCC GTGGTCGTGG
TGGCCACGGC CTTTGCGGTG GTGGCCGTGC GCGGCGAGCA GTGCGGCAGC CAGGCCGGCG GCGCGCTCTG CCCCAACTGC
CTCTGCTGCA GCCAGTACGG CTGGTGCGGA TCCACCTCCG CCTACTGCGG CTCCGGCTGC CAGAGCCAGT GCTCCGGCAG
CTGCGGCGGC GGCGGCCCGA CCCCGCCCTC CGGCGGTGGC GGCAGCGGCG TCGCCTCCAT CGTGTCGCGC TCGCTCTTCG
ACCAGATGCT TCTCCACCGC AACGACGCGG CGTGCCCGGC CAAGAACTTC TACACCTACG ACGCCTTCGT CGCCGCCGCC
AACGCCTTCC CGAGCTTCGC CACAACCGGC GACGCCGCCA CCCGCAAGCG CGAGGTCGCC GCGTTCCTGG CGCAGACGTC
GCACGAGACC ACGGGCGGGT GGGCGACGGC GCCCGATGGC CCCTACTCGT GGGGCTACTG CTTCAAGGAG GAGAACAACG
GCAACGTTGG GTCCGACTAC TGTGTCCAGA GCTCGCAGTG GCCGTGCGCC GCCGGCAAGA AGTACTACGG CCGGGGACCC
ATCCAGATCT CCTACAACTA CAACTACGGC CCGGCGGGGC AGGCCATCGG CTCCAACCTG CTGAGCAACC CGGACCTGGT
GGCGTCGGAC GCCACCGTCT CCTTCAAGAC GGCGTTCTGG TTCTGGATGA CGCCGCAGTC GCCCAAGCCG TCGTGCCACG
CGGTGATGAC AGGGCAGTGG ACGCCCAACG GCAACGACCA GGCGGCGGGG CGCGTGCCGG GCTACGGCGT GGTGACCAAC
ATCATCAACG GCGGCGTGGA GTGCGGCCAC GGCGCGGACA GCAGAGTCGC CGACCGGATT GGGTTCTACA AGCGCTACTG
CGACATGTTG GGCGTCAGCT ACGGCGCCAA CTTGGACTGC TACAACCAGA GGCCTTTCAA CTCCTAATAG CTCGTTCTAG
CTTCAAGCTT TGCACTGATA ACCACTGATC GGATGCTTTA CATCGATGAA TAAGAATTCA TCCGAGCAGA CAAATAATAC
AATCATCAGT AATGCCCACA ATGGCTGATG GAAAATATAT TGTGCTTCCG ATTATTAATA ATTAATACTT CTACATAATA
AACAAGATAC GCTCTCC

Locus: Os06g0726200

Loading...

Locus: Os06g0726200

Loading...