Os06t0728700-01

Locus

Os06g0728700

Description

Homeodomain-like containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

EPR1

CGSNL Gene Name

EARLY PHYTOCHROME RESPONSIVE 1

Oryzabase Gene Symbol Synonym(s)

OsEPR1

Oryzabase Gene Name Synonym(s)

MYB transcription factor, OsLHY-like_chr.6, EARLY PHYTOCHROME RESPONSIVE1, EARLY PHYTOCHROME RESPONSIVE 1

Transcript Evidence

AK119632 (DDBJ, Best hit)

AK111637 (DDBJ, Best hit)

Protein Evidence

B5AEI9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

SANT domain, DNA binding (IPR001005)

Myb-like DNA-binding domain, SHAQKYF class (IPR006447)

Homeodomain-like (IPR009057)

Homeodomain-related (IPR012287)

Myb, DNA-binding (IPR014778)

Transcription regulator HTH, Myb-type, DNA-binding (IPR017930)

Full-length cDNA

002-130-E11 (Online Clone Ordering)

J013123B09 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0728700-01)

RiceXPro (AK119632)

Others

Oryzabase (9685)

KEGG (Os06t0728700-01)

Transcript

1930 bp

>Os06t0728700-01 Homeodomain-like containing protein.
AGTTTCCTCTTCCTCTCGCATCCTAGCGGCAGCGGCAGCGGCAGCCTCCTCCTCCTCCGC
CGCCGCCGCTCCTCTTCCCTCTCCCAACTCCCGTACGGGCGTACGGCCGCCTCGTCGCCG
GATTTTTTTTTTCGTTCCCCCGGCGAGCTTGCACTCTCTTTTCTTCGATTCTCTTTCGGC
TTTGCTTCTTCGGTCGCTTTTTTTTTTGGCTGTTCCTGGTCGATCCCGGCGAAGGAGGTG
GTCGGGAAGCAAGATTTGAACTACTCCTCCTCATGGCTTCCATGCCGCAGCTGGAGGAAA
AGGATTCATCCGATTTGGCAATCAACAAAGGCCCGTCGCTGGATCTTGTCAAATCTCCCT
TGATGATGAATGATGCATCTGCAACTGTAACTGCAATGCAGCCCAACGAGGGGATGGAGG
AGTTCCCTGTCAAGGTTCGGAAGCCTTACACGATCACCAAGCAGCGGGAGAAGTGGACGG
AAGAAGAGCACGACAAGTTCCTTGAGGCATTGAAGCTGTATGGTCGCTCTTGGCGTCAGA
TACAAGAGCACATTGGCACAAAGACTGCTGTCCAAATTCGGAGCCATGCCCAGAAGTTTT
TCTCAAAGGTGGTGCGTGAGCCCGGTTCCAATAATGCGATTGAGATCCCTCCACCTAGGC
CAAAGAGAAAACCACTTCATCCGTACCCTCGAAAGTGTGCGAATTCTGGATCGGACGCAA
ATCCAGCAACAGCGCAATTGAAGCTTGCTCCTGGCTCATCTTCATCTGGCTCTGATCAAG
AGAATGGTTCTCCTATATCGGTGCTATCTGCGATGCAGTCAGATGCTTTTGGATCGTCAG
TATCCAATCCATCAACCAGATGTACCTCCCCAGCGTCATCTGACGATGGAAATAACATTC
CCACATTCACGAGTGGGGAAGATAATAATGTGCCTTGTGAACCAACAGTGATAGATCCGT
CCCAGTCCCACAAGGAAATAGACCAAGATAGAAAAGACGTGAATAATATGTCTGAAGAGG
ATTCTTCAGAAGAAGAGGTGCAAGAAACAAGCTTGAAGCTATTTGGGAGGACAGTTGTCA
TCCCAGATCCAAGGAAGAGAAGCTCCTCAGATCCGAAGCATGAAAGTGAGGAGCAGATAT
CACAGCCTTCCAATGAAGAAATGTTGCAGGCTTCTTCATCGGTTGGGGAGATTCCAGCGG
CATATTGTGCACCAAATGGTTGGTTTATGTCATACAATTCTTTCCCATTCCAATTCGGTG
AATCAGCGGCAGATGCTAGAATTCCCCCTTTACACGTGTGGTGGCCTTACTACGGTTTTG
CTCCCATTAGCCATCCTAGAGGACTAAGCACAGTGATGCAGCAGACTGAAGGTAGTGACG
AGAGTGACGGTGTGAAGAGCCACTCATCCGAATCAAGTTCGGACTCCGGGGAAAATGTGC
AGATGACCGCTCCCCAGAGCTCGAGAATAGTGGAATCACTTGGAGCGATTTACGTCCGAG
ACTCAGGTTCAAGTTTTGAGCTAAAACCGAGCGCAAATTCAGCGTTTGTAAGAGTGAAGC
CAAGCAACAGCGGAGATGAAGAGGTAATAAGGGGATTTGTGCCTTATAAAAGATGCAAAT
TTCAATAACGCAGGCAAGCGGGTATTTTCTTGAAAGCTGCTAATTTAACAGAGAAGAGTA
GGAGCACGAACGTTGCTTGCATCACTGTATTTTTTTTTGTTTGTTTGCGGGGATTGGTGG
TGCATTAATGAATTGTTTGCTGCTTGCACCTTAAAAAGGATAGAGATGGTGTAAGCAGTT
TGTTGCTGTAAGAATGTTACATGTAGACTAGTACTTAAAATTATAGGGGATGCCAATCTC
TGCCCTGATGATGTTGTAAAAGCAGTACGCACCATGTTTTACCTCTGGTTGAAAGCTAAG
CTGTTAATGG

CDS

1356 bp

>Os06t0728700-01 Homeodomain-like containing protein.
ATGGCTTCCATGCCGCAGCTGGAGGAAAAGGATTCATCCGATTTGGCAATCAACAAAGGC
CCGTCGCTGGATCTTGTCAAATCTCCCTTGATGATGAATGATGCATCTGCAACTGTAACT
GCAATGCAGCCCAACGAGGGGATGGAGGAGTTCCCTGTCAAGGTTCGGAAGCCTTACACG
ATCACCAAGCAGCGGGAGAAGTGGACGGAAGAAGAGCACGACAAGTTCCTTGAGGCATTG
AAGCTGTATGGTCGCTCTTGGCGTCAGATACAAGAGCACATTGGCACAAAGACTGCTGTC
CAAATTCGGAGCCATGCCCAGAAGTTTTTCTCAAAGGTGGTGCGTGAGCCCGGTTCCAAT
AATGCGATTGAGATCCCTCCACCTAGGCCAAAGAGAAAACCACTTCATCCGTACCCTCGA
AAGTGTGCGAATTCTGGATCGGACGCAAATCCAGCAACAGCGCAATTGAAGCTTGCTCCT
GGCTCATCTTCATCTGGCTCTGATCAAGAGAATGGTTCTCCTATATCGGTGCTATCTGCG
ATGCAGTCAGATGCTTTTGGATCGTCAGTATCCAATCCATCAACCAGATGTACCTCCCCA
GCGTCATCTGACGATGGAAATAACATTCCCACATTCACGAGTGGGGAAGATAATAATGTG
CCTTGTGAACCAACAGTGATAGATCCGTCCCAGTCCCACAAGGAAATAGACCAAGATAGA
AAAGACGTGAATAATATGTCTGAAGAGGATTCTTCAGAAGAAGAGGTGCAAGAAACAAGC
TTGAAGCTATTTGGGAGGACAGTTGTCATCCCAGATCCAAGGAAGAGAAGCTCCTCAGAT
CCGAAGCATGAAAGTGAGGAGCAGATATCACAGCCTTCCAATGAAGAAATGTTGCAGGCT
TCTTCATCGGTTGGGGAGATTCCAGCGGCATATTGTGCACCAAATGGTTGGTTTATGTCA
TACAATTCTTTCCCATTCCAATTCGGTGAATCAGCGGCAGATGCTAGAATTCCCCCTTTA
CACGTGTGGTGGCCTTACTACGGTTTTGCTCCCATTAGCCATCCTAGAGGACTAAGCACA
GTGATGCAGCAGACTGAAGGTAGTGACGAGAGTGACGGTGTGAAGAGCCACTCATCCGAA
TCAAGTTCGGACTCCGGGGAAAATGTGCAGATGACCGCTCCCCAGAGCTCGAGAATAGTG
GAATCACTTGGAGCGATTTACGTCCGAGACTCAGGTTCAAGTTTTGAGCTAAAACCGAGC
GCAAATTCAGCGTTTGTAAGAGTGAAGCCAAGCAACAGCGGAGATGAAGAGGTAATAAGG
GGATTTGTGCCTTATAAAAGATGCAAATTTCAATAA

Protein

452 aa

>Os06t0728700-01 Homeodomain-like containing protein.
MASMPQLEEKDSSDLAINKGPSLDLVKSPLMMNDASATVTAMQPNEGMEEFPVKVRKPYT
ITKQREKWTEEEHDKFLEALKLYGRSWRQIQEHIGTKTAVQIRSHAQKFFSKVVREPGSN
NAIEIPPPRPKRKPLHPYPRKCANSGSDANPATAQLKLAPGSSSSGSDQENGSPISVLSA
MQSDAFGSSVSNPSTRCTSPASSDDGNNIPTFTSGEDNNVPCEPTVIDPSQSHKEIDQDR
KDVNNMSEEDSSEEEVQETSLKLFGRTVVIPDPRKRSSSDPKHESEEQISQPSNEEMLQA
SSSVGEIPAAYCAPNGWFMSYNSFPFQFGESAADARIPPLHVWWPYYGFAPISHPRGLST
VMQQTEGSDESDGVKSHSSESSSDSGENVQMTAPQSSRIVESLGAIYVRDSGSSFELKPS
ANSAFVRVKPSNSGDEEVIRGFVPYKRCKFQ*

5'UTR

chr06:31028713..31028984 (- strand) : 272 bp

CDS

chr06:31028689..31028712 (- strand) : 24 bp

chr06:31027975..31028112 (- strand) : 138 bp

chr06:31027727..31027838 (- strand) : 112 bp

chr06:31027561..31027622 (- strand) : 62 bp

chr06:31027020..31027385 (- strand) : 366 bp

chr06:31026274..31026927 (- strand) : 654 bp

3'UTR

chr06:31025972..31026273 (- strand) : 302 bp

FASTA

>Os06t0728700-01 class=Sequence position=chr06:31025972..31028984 (- strand)
AGTTTCCTCT TCCTCTCGCA TCCTAGCGGC AGCGGCAGCG GCAGCCTCCT CCTCCTCCGC CGCCGCCGCT CCTCTTCCCT
CTCCCAACTC CCGTACGGGC GTACGGCCGC CTCGTCGCCG GATTTTTTTT TTCGTTCCCC CGGCGAGCTT GCACTCTCTT
TTCTTCGATT CTCTTTCGGC TTTGCTTCTT CGGTCGCTTT TTTTTTTGGC TGTTCCTGGT CGATCCCGGC GAAGGAGGTG
GTCGGGAAGC AAGATTTGAA CTACTCCTCC TCATGGCTTC CATGCCGCAG CTGGAGGTAA AGATCTCCTC ATATATAGCC
AGGTTGCTCT TCTTTTTCTT TTTCTGGCCT TGCGCAACCG CTGATAGAGA GTTTGATGAT GATTTGTGTG GTCATTTGCT
TAACTTTGCA GATTTTATTT GCAAAAATAT ATTTTTCCTG GACCGATCCA TTATTATTGC CTAAAAAAAC AAATGTATTG
CAATTTTTTA GTTAAAAAAT GGGAGTGTTC TAGATGCTTC TCTCCTGGTT CTGGGGCGGA TACACGTCAT AATTATCTAT
CTTTAGAGGC TTCCAGAACG ACATGGGATG GCCAATACTC CTCCTATACT CTCTCTCTCC AATAACGGCA CGAATCCTCA
ATTAACAAAT CCTTCTGCCT CTGCTTACTG GAGTACTACA CTACACTAGG TAGCAATTCT GTTTCTACTA CTACTTTTTA
CTAGTAATTA TCCCTCCCTT TGCAGCGGTA AGTGGTACTA GTAACTACGG AGTTGTTGTT GTAAACTGTC TGCGGCAATT
GCAAATTATA CGAGTACTTG TGTATGCTTT TGCTAAAGCA CTGAACTTTG TGTTCCTCTC CTGGCCATCT AGGAAAAGGA
TTCATCCGAT TTGGCAATCA ACAAAGGCCC GTCGCTGGAT CTTGTCAAAT CTCCCTTGAT GATGAATGAT GCATCTGCAA
CTGTAACTGC AATGCAGCCC AACGAGGGGA TGGAGGAGTT CCCTGTCAAG GTACTTTTGA CATCTATGCA AGCCGATCCT
TCTTCACTAG CATGTCTTAC TGGCAGAGAG GAACAGAAAA AATTGTACTT CTAGCTTACA GCGTTGTCAC TGTACCTAAC
AATCTCCAAC CCAATGTTTG AAGCAGGTTC GGAAGCCTTA CACGATCACC AAGCAGCGGG AGAAGTGGAC GGAAGAAGAG
CACGACAAGT TCCTTGAGGC ATTGAAGCTG TATGGTCGCT CTTGGCGTCA GATACAAGGT GCGTTTTGGC CTCTCTCTCT
CTCTCTTCAT ATTTTTGCCT TACATTAGGC TTTAAACAAG TTCAGTGAGT AGTATGTCTG ATTTGTCCAA GCTGTTCTCT
AGAGCACATT GGCACAAAGA CTGCTGTCCA AATTCGGAGC CATGCCCAGA AGTTTTTCTC AAAGGTGATA TAATAATCCT
TCATGTACCA ATTGATCAAT CTGATTGATT TATTACTACA CTGCCGATGC TATATTTTTC TCTATATATA TATTACATGT
GCTTGTAAAG CAGAATTGGT AACAGTAAAC TTGAAATGGC ATGCTCAAAC GTTTCTAATG CGGGGGCTTT ATTTAGCAGG
TGGTGCGTGA GCCCGGTTCC AATAATGCGA TTGAGATCCC TCCACCTAGG CCAAAGAGAA AACCACTTCA TCCGTACCCT
CGAAAGTGTG CGAATTCTGG ATCGGACGCA AATCCAGCAA CAGCGCAATT GAAGCTTGCT CCTGGCTCAT CTTCATCTGG
CTCTGATCAA GAGAATGGTT CTCCTATATC GGTGCTATCT GCGATGCAGT CAGATGCTTT TGGATCGTCA GTATCCAATC
CATCAACCAG ATGTACCTCC CCAGCGTCAT CTGACGATGG AAATAACATT CCCACATTCA CGAGTGGGGA AGATAATAAT
GTGCCTTGTG AACCAACAGT GATAGATCCG TCCCAGTCCC ACAAGGTAAA CATCCATCCT TCGAATGAAT CTTTTTGTCA
AACATGGTAA ATCGCCACTT CATCAGCTTA TTAGGGTTAT ACATGTTTCT GTCACAGGAA ATAGACCAAG ATAGAAAAGA
CGTGAATAAT ATGTCTGAAG AGGATTCTTC AGAAGAAGAG GTGCAAGAAA CAAGCTTGAA GCTATTTGGG AGGACAGTTG
TCATCCCAGA TCCAAGGAAG AGAAGCTCCT CAGATCCGAA GCATGAAAGT GAGGAGCAGA TATCACAGCC TTCCAATGAA
GAAATGTTGC AGGCTTCTTC ATCGGTTGGG GAGATTCCAG CGGCATATTG TGCACCAAAT GGTTGGTTTA TGTCATACAA
TTCTTTCCCA TTCCAATTCG GTGAATCAGC GGCAGATGCT AGAATTCCCC CTTTACACGT GTGGTGGCCT TACTACGGTT
TTGCTCCCAT TAGCCATCCT AGAGGACTAA GCACAGTGAT GCAGCAGACT GAAGGTAGTG ACGAGAGTGA CGGTGTGAAG
AGCCACTCAT CCGAATCAAG TTCGGACTCC GGGGAAAATG TGCAGATGAC CGCTCCCCAG AGCTCGAGAA TAGTGGAATC
ACTTGGAGCG ATTTACGTCC GAGACTCAGG TTCAAGTTTT GAGCTAAAAC CGAGCGCAAA TTCAGCGTTT GTAAGAGTGA
AGCCAAGCAA CAGCGGAGAT GAAGAGGTAA TAAGGGGATT TGTGCCTTAT AAAAGATGCA AATTTCAATA ACGCAGGCAA
GCGGGTATTT TCTTGAAAGC TGCTAATTTA ACAGAGAAGA GTAGGAGCAC GAACGTTGCT TGCATCACTG TATTTTTTTT
TGTTTGTTTG CGGGGATTGG TGGTGCATTA ATGAATTGTT TGCTGCTTGC ACCTTAAAAA GGATAGAGAT GGTGTAAGCA
GTTTGTTGCT GTAAGAATGT TACATGTAGA CTAGTACTTA AAATTATAGG GGATGCCAAT CTCTGCCCTG ATGATGTTGT
AAAAGCAGTA CGCACCATGT TTTACCTCTG GTTGAAAGCT AAGCTGTTAA TGG

Locus: Os06g0728700

Loading...

Locus: Os06g0728700

Loading...