Os06t0729000-01

Locus

Os06g0729000

Description

Phytoene synthase 1 (EC 2.5.1.32).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PSY1

CGSNL Gene Name

PHYTOENE SYNTHASE 1

Oryzabase Gene Symbol Synonym(s)

PSY1, OsPSY1

Oryzabase Gene Name Synonym(s)

phytoene synthase 1, PSY1-like gene

Transcript Evidence

AK070716 (DDBJ, Best hit)

Protein Evidence

Q6KBZ6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: transferase activity (GO:0016740)

Molecular Function: transferase activity, transferring alkyl or aryl (other than methyl) groups (GO:0016765)

Functional domain (InterPro)

Squalene/phytoene synthase (IPR002060)

Terpenoid synthase (IPR008949)

Squalene/phytoene synthase, conserved site (IPR019845)

Full-length cDNA

J023057D05 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0729000-01)

RiceXPro (AK070716)

Others

Oryzabase (8086)

KEGG (Os06t0729000-01 (EC:2.5.1.32))

Transcript

1898 bp

>Os06t0729000-01 Phytoene synthase 1 (EC 2.5.1.32).
ATAGCCATAGCTCATCATCCACCCTCTCTTCCTTCCTTCCTTCCTTCCTTCCACACAGAC
CAGACCAGGCATCCCGACACTACACGCAGACTCTCGACTTTGTCACTAGCATCATTGCTT
GATGATCGATGCTGAGCTGCAACCAAGCACCAGCATATCCTTTCCTTCATTCCTTCCTGG
TGCTGGTAGAAGAAGAACAAGCTAGCTAGAGTGATAAGAGCTAGCTACCTTGCAGATCGA
TCTCCGGCCAGCGATTGATCCCATCCAGTATAATAATGGCGGCCATCACGCTCCTACGTT
CAGCGTCTCTTCCGGGCCTCTCCGACGCCCTCGCCCGGGACGCTGCTGCCGTCCAACATG
TCTGCTCCTCCTACCTGCCCAACAACAAGGAGAAGAAGAGGAGGTGGATCCTCTGCTCGC
TCAAGTACGCCTGCCTTGGCGTCGACCCTGCCCCGGGCGAGATTGCCCGGACCTCGCCGG
TGTACTCCAGCCTCACCGTCACCCCTGCTGGAGAGGCCGTCATCTCCTCGGAGCAGAAGG
TGTACGACGTCGTCCTCAAGCAGGCAGCATTGCTCAAACGCCACCTGCGCCCACAACCAC
ACACCATTCCCATCGTTCCCAAGGACCTGGACCTGCCAAGAAACGGCCTCAAGCAGGCCT
ATCATCGCTGCGGAGAGATCTGCGAGGAGTATGCCAAGACCTTTTACCTTGGAACTATGC
TCATGACGGAGGACCGACGGCGCGCCATATGGGCCATCTATGTGTGGTGTAGGAGGACAG
ATGAGCTTGTAGATGGACCAAATGCCTCGCACATCACACCGTCAGCCCTGGACCGGTGGG
AGAAGAGGCTTGATGATCTCTTCACCGGACGCCCCTACGACATGCTTGATGCTGCACTTT
CTGATACCATCTCCAAGTTTCCTATAGATATTCAGCCTTTCAGGGACATGATAGAAGGGA
TGCGGTCAGACCTCAGAAAGACTAGATACAAGAACTTCGACGAGCTCTACATGTACTGCT
ACTATGTTGCTGGAACTGTGGGGCTAATGAGTGTTCCTGTGATGGGTATTGCACCCGAGT
CGAAGGCAACAACTGAAAGTGTGTACAGTGCTGCTTTGGCTCTCGGCATTGCAAACCAGC
TCACAAATATACTCCGTGACGTTGGAGAGGACGCGAGAAGAGGGAGGATATATTTACCAC
AAGATGAACTTGCAGAGGCAGGGCTCTCTGATGAGGACATCTTCAATGGCGTTGTGACTA
ACAAATGGAGAAGCTTCATGAAGAGACAGATCAAGAGAGCTAGGATGTTTTTTGAGGAGG
CAGAGAGAGGGGTGACCGAGCTCAGCCAGGCAAGCCGGTGGCCGGTCTGGGCGTCTCTGT
TGTTATACCGGCAAATCCTTGACGAGATAGAAGCAAACGATTACAACAACTTCACAAAGA
GGGCGTACGTTGGGAAGGCGAAGAAATTGCTAGCGCTTCCAGTTGCATATGGTAGATCAT
TGCTGATGCCCTACTCACTGAGAAATAGCCAGAAGTAGGAGGCGGGAAGAGGAGATAAAG
GGAAGATGATGAGCAGGTTAGGCTTAGATAGGAAAAATCAGACAGCATCTGCCTTCCGAT
TAATGTTGAGGAAATTATATTATTGTGTGTATCATACATAGCATGTATAGGGAAAATGCT
GCAGGCAGGCAGGCAGGCTAGGTGATGGTTGAATATTTCCTTCACATCATGTATGTATAT
CCTTCCTTGATGCTACAGCACATATGTATGTATGACTCTGAAGAAAGAGCAACCTGTATA
GTAGCTAACCGGCTATGGCCTATGTATGGGCCGCAGAGGTGAGCAAACAAAAATCATCAT
CCATGGATTGATTGATTGATTGATTGATACAGTACTAC

CDS

1263 bp

>Os06t0729000-01 Phytoene synthase 1 (EC 2.5.1.32).
ATGGCGGCCATCACGCTCCTACGTTCAGCGTCTCTTCCGGGCCTCTCCGACGCCCTCGCC
CGGGACGCTGCTGCCGTCCAACATGTCTGCTCCTCCTACCTGCCCAACAACAAGGAGAAG
AAGAGGAGGTGGATCCTCTGCTCGCTCAAGTACGCCTGCCTTGGCGTCGACCCTGCCCCG
GGCGAGATTGCCCGGACCTCGCCGGTGTACTCCAGCCTCACCGTCACCCCTGCTGGAGAG
GCCGTCATCTCCTCGGAGCAGAAGGTGTACGACGTCGTCCTCAAGCAGGCAGCATTGCTC
AAACGCCACCTGCGCCCACAACCACACACCATTCCCATCGTTCCCAAGGACCTGGACCTG
CCAAGAAACGGCCTCAAGCAGGCCTATCATCGCTGCGGAGAGATCTGCGAGGAGTATGCC
AAGACCTTTTACCTTGGAACTATGCTCATGACGGAGGACCGACGGCGCGCCATATGGGCC
ATCTATGTGTGGTGTAGGAGGACAGATGAGCTTGTAGATGGACCAAATGCCTCGCACATC
ACACCGTCAGCCCTGGACCGGTGGGAGAAGAGGCTTGATGATCTCTTCACCGGACGCCCC
TACGACATGCTTGATGCTGCACTTTCTGATACCATCTCCAAGTTTCCTATAGATATTCAG
CCTTTCAGGGACATGATAGAAGGGATGCGGTCAGACCTCAGAAAGACTAGATACAAGAAC
TTCGACGAGCTCTACATGTACTGCTACTATGTTGCTGGAACTGTGGGGCTAATGAGTGTT
CCTGTGATGGGTATTGCACCCGAGTCGAAGGCAACAACTGAAAGTGTGTACAGTGCTGCT
TTGGCTCTCGGCATTGCAAACCAGCTCACAAATATACTCCGTGACGTTGGAGAGGACGCG
AGAAGAGGGAGGATATATTTACCACAAGATGAACTTGCAGAGGCAGGGCTCTCTGATGAG
GACATCTTCAATGGCGTTGTGACTAACAAATGGAGAAGCTTCATGAAGAGACAGATCAAG
AGAGCTAGGATGTTTTTTGAGGAGGCAGAGAGAGGGGTGACCGAGCTCAGCCAGGCAAGC
CGGTGGCCGGTCTGGGCGTCTCTGTTGTTATACCGGCAAATCCTTGACGAGATAGAAGCA
AACGATTACAACAACTTCACAAAGAGGGCGTACGTTGGGAAGGCGAAGAAATTGCTAGCG
CTTCCAGTTGCATATGGTAGATCATTGCTGATGCCCTACTCACTGAGAAATAGCCAGAAG
TAG

Protein

421 aa

>Os06t0729000-01 Phytoene synthase 1 (EC 2.5.1.32).
MAAITLLRSASLPGLSDALARDAAAVQHVCSSYLPNNKEKKRRWILCSLKYACLGVDPAP
GEIARTSPVYSSLTVTPAGEAVISSEQKVYDVVLKQAALLKRHLRPQPHTIPIVPKDLDL
PRNGLKQAYHRCGEICEEYAKTFYLGTMLMTEDRRRAIWAIYVWCRRTDELVDGPNASHI
TPSALDRWEKRLDDLFTGRPYDMLDAALSDTISKFPIDIQPFRDMIEGMRSDLRKTRYKN
FDELYMYCYYVAGTVGLMSVPVMGIAPESKATTESVYSAALALGIANQLTNILRDVGEDA
RRGRIYLPQDELAEAGLSDEDIFNGVVTNKWRSFMKRQIKRARMFFEEAERGVTELSQAS
RWPVWASLLLYRQILDEIEANDYNNFTKRAYVGKAKKLLALPVAYGRSLLMPYSLRNSQK
*

5'UTR

chr06:31055700..31055919 (- strand) : 220 bp

chr06:31055357..31055411 (- strand) : 55 bp

CDS

chr06:31054921..31055356 (- strand) : 436 bp

chr06:31054761..31054811 (- strand) : 51 bp

chr06:31053760..31053932 (- strand) : 173 bp

chr06:31052927..31053162 (- strand) : 236 bp

chr06:31052630..31052822 (- strand) : 193 bp

chr06:31052343..31052516 (- strand) : 174 bp

3'UTR

chr06:31051983..31052342 (- strand) : 360 bp

FASTA

>Os06t0729000-01 class=Sequence position=chr06:31051983..31055919 (- strand)
ATAGCCATAG CTCATCATCC ACCCTCTCTT CCTTCCTTCC TTCCTTCCTT CCACACAGAC CAGACCAGGC ATCCCGACAC
TACACGCAGA CTCTCGACTT TGTCACTAGC ATCATTGCTT GATGATCGAT GCTGAGCTGC AACCAAGCAC CAGCATATCC
TTTCCTTCAT TCCTTCCTGG TGCTGGTAGA AGAAGAACAA GCTAGCTAGA GTGATAAGAG GTAATTGTTT CCTCCAACTC
ATTCCAACCT TGCCTTTTGC CTGCCAAACT CCTCATCCTC TGCCACTGCA TACCATACGT GTGCGCGCCT GAATGCCTGC
CTGCCTGCCT GATACTGATA CATACACACA GCACACACGC CCCGCTATTG TAAGTGCGGC CACCACTAGC TGTGTTTCTG
CTCTCTGTGT TTATCACCAA ATTAAAGCAA CGACACTCAC TTGGTCTGTT TCTTTTTAAA ATATTATTTC TCCTCCTCAC
CTCACACATA CCTGCATATT ATTTGCAGCT AGCTACCTTG CAGATCGATC TCCGGCCAGC GATTGATCCC ATCCAGTATA
ATAATGGCGG CCATCACGCT CCTACGTTCA GCGTCTCTTC CGGGCCTCTC CGACGCCCTC GCCCGGGACG CTGCTGCCGT
CCAACATGTC TGCTCCTCCT ACCTGCCCAA CAACAAGGAG AAGAAGAGGA GGTGGATCCT CTGCTCGCTC AAGTACGCCT
GCCTTGGCGT CGACCCTGCC CCGGGCGAGA TTGCCCGGAC CTCGCCGGTG TACTCCAGCC TCACCGTCAC CCCTGCTGGA
GAGGCCGTCA TCTCCTCGGA GCAGAAGGTG TACGACGTCG TCCTCAAGCA GGCAGCATTG CTCAAACGCC ACCTGCGCCC
ACAACCACAC ACCATTCCCA TCGTTCCCAA GGACCTGGAC CTGCCAAGAA ACGGCCTCAA GCAGGCCTAT CATCGCTGCG
GAGAGATCTG CGAGGAGTAT GCCAAGACCT TTTACCTTGG TATGTAGTAT GTCTATCTTC TTAATTTTCA CCCCTGCCTT
GCAGCGTGCC ATCCATTTTT TCTTGCCATG CATCATATCA TGGAATTCAT GCTGCTTTCT CATGGCAGGA ACTATGCTCA
TGACGGAGGA CCGACGGCGC GCCATATGGG CCATCTATGG TACTTCAACA ATCACCATGT CTTGCTCCAC TGTTCCATTG
CTTCCCTAAC TATGTATCAG TAAATATTAA AAGCGGAGGT AATTTAATTT TTTAATTCAA ATCATCAGAT ATCCCCTCAC
GTTTAATATG AGTTGAAGGT CACTATATAG tactccctcc gtttcaaaat gtttgacacc attgactttt taatacatgt
ttgaccattc gtcttattca aaaaaatttg tgaaatatgt aaaactatat ctgtatatga aagtatattt aacaatgaat
caaatgatat gaaaagaata aataattact tatatttttt gaataagacg aatggtcaaa cacgtactaa aaagtcaacg
gtgtcaagta ttttgaaacg aatggagtaT TGAATAGTAA CCTACTGTTT GAGTTGAAGG TTGCTGTACT ACTTACTATT
TAACAGCGAC TAGCAAGACA CAAATTGGTC AAGTTTTGAT GTAATGGTCA GAATTAGGTT ATTGATGGGA GTTATAACAG
ACAGAAACTT TGTCGTCAGA CTTCACTTGC ATGCGATGCA TCTGTAGATA CAAAGTCAAT GAAGAATAAA GTACTAATAG
TACTAGTGCA TTTCTTTTAA AACCACTATC TATGCAAGCA TCACAATTGG ACTTGTAGTA GGCTAAATGG CTCCAACTGT
TTCAAGACAT GTGAAAAAGG TTGAGAGAAC ATGTTCTCTG AGATGCCAAA TGAATATGAA TCCGTACTAC TAACAATTTC
AAACTTTTAA ATGAGCTAGT TCAGGCATGA ATTTTGAAAT CTGATGTATA CCTTTTTTTT TTTGCAGTGT GGTGTAGGAG
GACAGATGAG CTTGTAGATG GACCAAATGC CTCGCACATC ACACCGTCAG CCCTGGACCG GTGGGAGAAG AGGCTTGATG
ATCTCTTCAC CGGACGCCCC TACGACATGC TTGATGCTGC ACTTTCTGAT ACCATCTCCA AGTTTCCTAT AGATATTCAG
GTAACTAGCT GGTATATGCA TATAGCGAAA ATCCAAATGA TGTAATACTG CTAGACTATA TTGGTTGCTA ATCCCTATGG
ATTCCCTGCA CATCGCAATT CTAGTGCAAG AAGAATAGAC CTACTAAGTT GACGACCAAA TAGTTGATCG GTCAACAATA
TCATATGACT TGTCAGCCAT TAGTCTCTGA TGCCACTGTT AACTTTTCAC ACAATTTATT GGGCTTAGTC CAGGACTCCA
TGTGGCCACA ATGCACAGTA TTAGTCTAGG AAAAAGATCA ATCCAAGGAC AGATATGGTA GGACTTTTCA GAACAGACAA
CTGATAGAGC ACAGCCCATC AAGTAGAATA CTAAGGGGAA GGCCATAATT CCTATGCAAT TCTATGGAGT TGTTAACCTG
AATTAAGCAG GTTCTATACA GAATAAAAGA ACTTGCTCAT TATCTATGAT GACAAAAAAG GAAGGAAAAG TTCCACTGAG
AATTTTACTG AACACATGAA AACCCACAAT TGGAAACTTA TCATCTGTCC TTTGAGTTTT TACAGACCAC ATGGTGTATA
ATAATATGAC TAATCAAATG CAATGCACGT ATGCCAGCCT TTCAGGGACA TGATAGAAGG GATGCGGTCA GACCTCAGAA
AGACTAGATA CAAGAACTTC GACGAGCTCT ACATGTACTG CTACTATGTT GCTGGAACTG TGGGGCTAAT GAGTGTTCCT
GTGATGGGTA TTGCACCCGA GTCGAAGGCA ACAACTGAAA GTGTGTACAG TGCTGCTTTG GCTCTCGGCA TTGCAAACCA
GCTCACAAAT ATACTCCGTG ACGTTGGAGA GGAGTAAGTG TCAATACAGT GGTTTTCACT AATGGTCATA AGCTGTAGAA
CAGAATGTCG GCATATATAT AGTTCACTGA TCCTAATACT TCATTTTATT TTCACAGCGC GAGAAGAGGG AGGATATATT
TACCACAAGA TGAACTTGCA GAGGCAGGGC TCTCTGATGA GGACATCTTC AATGGCGTTG TGACTAACAA ATGGAGAAGC
TTCATGAAGA GACAGATCAA GAGAGCTAGG ATGTTTTTTG AGGAGGCAGA GAGAGGGGTG ACCGAGCTCA GCCAGGCAAG
CCGGTGGCCG GTAAGAAGAG TCACTTGATT CTCAAGGAAA CATAAAGCAG ATTATTATTG TCGGTGCTTC TATGCCATGG
TGTCAAAAGG AAAATAAAAT ATCATTGCAT TGCCCCGTTG CAGGTCTGGG CGTCTCTGTT GTTATACCGG CAAATCCTTG
ACGAGATAGA AGCAAACGAT TACAACAACT TCACAAAGAG GGCGTACGTT GGGAAGGCGA AGAAATTGCT AGCGCTTCCA
GTTGCATATG GTAGATCATT GCTGATGCCC TACTCACTGA GAAATAGCCA GAAGTAGGAG GCGGGAAGAG GAGATAAAGG
GAAGATGATG AGCAGGTTAG GCTTAGATAG GAAAAATCAG ACAGCATCTG CCTTCCGATT AATGTTGAGG AAATTATATT
ATTGTGTGTA TCATACATAG CATGTATAGG GAAAATGCTG CAGGCAGGCA GGCAGGCTAG GTGATGGTTG AATATTTCCT
TCACATCATG TATGTATATC CTTCCTTGAT GCTACAGCAC ATATGTATGT ATGACTCTGA AGAAAGAGCA ACCTGTATAG
TAGCTAACCG GCTATGGCCT ATGTATGGGC CGCAGAGGTG AGCAAACAAA AATCATCATC CATGGATTGA TTGATTGATT
GATTGATACA GTACTAC