Os06t0729000-02

Locus

Os06g0729000

Description

Similar to Phytoene synthase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PSY1

CGSNL Gene Name

PHYTOENE SYNTHASE 1

Oryzabase Gene Symbol Synonym(s)

PSY1, OsPSY1

Oryzabase Gene Name Synonym(s)

phytoene synthase 1, PSY1-like gene

Transcript Evidence

AK067762 (DDBJ, Best hit)

Protein Evidence

Q6KBZ6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: transferase activity (GO:0016740)

Molecular Function: transferase activity, transferring alkyl or aryl (other than methyl) groups (GO:0016765)

Functional domain (InterPro)

Squalene/phytoene synthase (IPR002060)

Terpenoid synthase (IPR008949)

Squalene/phytoene synthase, conserved site (IPR019845)

Full-length cDNA

J013116E15 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0729000-02)

RiceXPro (AK067762)

Others

Oryzabase (8086)

KEGG (Os06t0729000-02 (EC:2.5.1.32))

Transcript

1288 bp

>Os06t0729000-02 Similar to Phytoene synthase.
CCATAGCTCATCATCCACCCTCTCTTCCTTCCTTCCTTCCTTCCTTCCACACAGACCAGA
CCAGGCATCCCGACACTACACGCAGACTCTCGACTTTGTCACTAGCATCATTGCTTGATG
ATCGATGCTGAGCTGCAACCAAGCACCAGCATATCCTTTCCTTCATTCCTTCCTGGTGCT
GGTAGAAGAAGAACAAGCTAGCTAGAGTGATAAGAGCTAGCTACCTTGCAGATCGATCTC
CGGCCAGCGATTGATCCCATCCAGTATAATAATGGCGGCCATCACGCTCCTACGTTCAGC
GTCTCTTCCGGGCCTCTCCGACGCCCTCGCCCGGGACGCTGCTGCCGTCCAACATGTCTG
CTCCTCCTACCTGCCCAACAACAAGGAGAAGAAGAGGAGGTGGATCCTCTGCTCGCTCAA
AAAGACTAGATACAAGAACTTCGACGAGCTCTACATGTACTGCTACTATGTTGCTGGAAC
TGTGGGGCTAATGAGTGTTCCTGTGATGGGTATTGCACCCGAGTCGAAGGCAACAACTGA
AAGTGTGTACAGTGCTGCTTTGGCTCTCGGCATTGCAAACCAGCTCACAAATATACTCCG
TGACGTTGGAGAGGACGCGAGAAGAGGGAGGATATATTTACCACAAGATGAACTTGCAGA
GGCAGGGCTCTCTGATGAGGACATCTTCAATGGCGTTGTGACTAACAAATGGAGAAGCTT
CATGAAGAGACAGATCAAGAGAGCTAGGATGTTTTTTGAGGAGGCAGAGAGAGGGGTGAC
CGAGCTCAGCCAGGCAAGCCGGTGGCCGGTCTGGGCGTCTCTGTTGTTATACCGGCAAAT
CCTTGACGAGATAGAAGCAAACGATTACAACAACTTCACAAAGAGGGCGTACGTTGGGAA
GGCGAAGAAATTGCTAGCGCTTCCAGTTGCATATGGTAGATCATTGCTGATGCCCTACTC
ACTGAGAAATAGCCAGAAGTAGGAGGCGGGAAGAGGAGATAAAGGGAAGATGATGAGCAG
GTTAGGCTTAGATAGGAAAAATCAGACAGCATCTGCCTTCCGATTAATGTTGAGGAAATT
ATATTATTGTGTGTATCATACATAGCATGTATAGGGAAAATGCTGCAGGCAGGCAGGCAG
GCTAGGTGATGGTTGAATATTTCCTTCACATCATGTATGTATATCCTTCCTTGATGCTAC
AGCACATATGTATGTATGACTCTGAAGAAAGAGCAACCTGTATAGTAGCTAACCGGCTAT
GGCCTATGTATGGGCCGCAGAGGTGAGC

CDS

711 bp

>Os06t0729000-02 Similar to Phytoene synthase.
ATGGCGGCCATCACGCTCCTACGTTCAGCGTCTCTTCCGGGCCTCTCCGACGCCCTCGCC
CGGGACGCTGCTGCCGTCCAACATGTCTGCTCCTCCTACCTGCCCAACAACAAGGAGAAG
AAGAGGAGGTGGATCCTCTGCTCGCTCAAAAAGACTAGATACAAGAACTTCGACGAGCTC
TACATGTACTGCTACTATGTTGCTGGAACTGTGGGGCTAATGAGTGTTCCTGTGATGGGT
ATTGCACCCGAGTCGAAGGCAACAACTGAAAGTGTGTACAGTGCTGCTTTGGCTCTCGGC
ATTGCAAACCAGCTCACAAATATACTCCGTGACGTTGGAGAGGACGCGAGAAGAGGGAGG
ATATATTTACCACAAGATGAACTTGCAGAGGCAGGGCTCTCTGATGAGGACATCTTCAAT
GGCGTTGTGACTAACAAATGGAGAAGCTTCATGAAGAGACAGATCAAGAGAGCTAGGATG
TTTTTTGAGGAGGCAGAGAGAGGGGTGACCGAGCTCAGCCAGGCAAGCCGGTGGCCGGTC
TGGGCGTCTCTGTTGTTATACCGGCAAATCCTTGACGAGATAGAAGCAAACGATTACAAC
AACTTCACAAAGAGGGCGTACGTTGGGAAGGCGAAGAAATTGCTAGCGCTTCCAGTTGCA
TATGGTAGATCATTGCTGATGCCCTACTCACTGAGAAATAGCCAGAAGTAG

Protein

237 aa

>Os06t0729000-02 Similar to Phytoene synthase.
MAAITLLRSASLPGLSDALARDAAAVQHVCSSYLPNNKEKKRRWILCSLKKTRYKNFDEL
YMYCYYVAGTVGLMSVPVMGIAPESKATTESVYSAALALGIANQLTNILRDVGEDARRGR
IYLPQDELAEAGLSDEDIFNGVVTNKWRSFMKRQIKRARMFFEEAERGVTELSQASRWPV
WASLLLYRQILDEIEANDYNNFTKRAYVGKAKKLLALPVAYGRSLLMPYSLRNSQK*

5'UTR

chr06:31055700..31055915 (- strand) : 216 bp

chr06:31055357..31055411 (- strand) : 55 bp

CDS

chr06:31055208..31055356 (- strand) : 149 bp

chr06:31052927..31053121 (- strand) : 195 bp

chr06:31052630..31052822 (- strand) : 193 bp

chr06:31052343..31052516 (- strand) : 174 bp

3'UTR

chr06:31052037..31052342 (- strand) : 306 bp

FASTA

>Os06t0729000-02 class=Sequence position=chr06:31052037..31055915 (- strand)
CCATAGCTCA TCATCCACCC TCTCTTCCTT CCTTCCTTCC TTCCTTCCAC ACAGACCAGA CCAGGCATCC CGACACTACA
CGCAGACTCT CGACTTTGTC ACTAGCATCA TTGCTTGATG ATCGATGCTG AGCTGCAACC AAGCACCAGC ATATCCTTTC
CTTCATTCCT TCCTGGTGCT GGTAGAAGAA GAACAAGCTA GCTAGAGTGA TAAGAGGTAA TTGTTTCCTC CAACTCATTC
CAACCTTGCC TTTTGCCTGC CAAACTCCTC ATCCTCTGCC ACTGCATACC ATACGTGTGC GCGCCTGAAT GCCTGCCTGC
CTGCCTGATA CTGATACATA CACACAGCAC ACACGCCCCG CTATTGTAAG TGCGGCCACC ACTAGCTGTG TTTCTGCTCT
CTGTGTTTAT CACCAAATTA AAGCAACGAC ACTCACTTGG TCTGTTTCTT TTTAAAATAT TATTTCTCCT CCTCACCTCA
CACATACCTG CATATTATTT GCAGCTAGCT ACCTTGCAGA TCGATCTCCG GCCAGCGATT GATCCCATCC AGTATAATAA
TGGCGGCCAT CACGCTCCTA CGTTCAGCGT CTCTTCCGGG CCTCTCCGAC GCCCTCGCCC GGGACGCTGC TGCCGTCCAA
CATGTCTGCT CCTCCTACCT GCCCAACAAC AAGGAGAAGA AGAGGAGGTG GATCCTCTGC TCGCTCAAGT ACGCCTGCCT
TGGCGTCGAC CCTGCCCCGG GCGAGATTGC CCGGACCTCG CCGGTGTACT CCAGCCTCAC CGTCACCCCT GCTGGAGAGG
CCGTCATCTC CTCGGAGCAG AAGGTGTACG ACGTCGTCCT CAAGCAGGCA GCATTGCTCA AACGCCACCT GCGCCCACAA
CCACACACCA TTCCCATCGT TCCCAAGGAC CTGGACCTGC CAAGAAACGG CCTCAAGCAG GCCTATCATC GCTGCGGAGA
GATCTGCGAG GAGTATGCCA AGACCTTTTA CCTTGGTATG TAGTATGTCT ATCTTCTTAA TTTTCACCCC TGCCTTGCAG
CGTGCCATCC ATTTTTTCTT GCCATGCATC ATATCATGGA ATTCATGCTG CTTTCTCATG GCAGGAACTA TGCTCATGAC
GGAGGACCGA CGGCGCGCCA TATGGGCCAT CTATGGTACT TCAACAATCA CCATGTCTTG CTCCACTGTT CCATTGCTTC
CCTAACTATG TATCAGTAAA TATTAAAAGC GGAGGTAATT TAATTTTTTA ATTCAAATCA TCAGATATCC CCTCACGTTT
AATATGAGTT GAAGGTCACT ATATAGtact ccctccgttt caaaatgttt gacaccattg actttttaat acatgtttga
ccattcgtct tattcaaaaa aatttgtgaa atatgtaaaa ctatatctgt atatgaaagt atatttaaca atgaatcaaa
tgatatgaaa agaataaata attacttata ttttttgaat aagacgaatg gtcaaacacg tactaaaaag tcaacggtgt
caagtatttt gaaacgaatg gagtaTTGAA TAGTAACCTA CTGTTTGAGT TGAAGGTTGC TGTACTACTT ACTATTTAAC
AGCGACTAGC AAGACACAAA TTGGTCAAGT TTTGATGTAA TGGTCAGAAT TAGGTTATTG ATGGGAGTTA TAACAGACAG
AAACTTTGTC GTCAGACTTC ACTTGCATGC GATGCATCTG TAGATACAAA GTCAATGAAG AATAAAGTAC TAATAGTACT
AGTGCATTTC TTTTAAAACC ACTATCTATG CAAGCATCAC AATTGGACTT GTAGTAGGCT AAATGGCTCC AACTGTTTCA
AGACATGTGA AAAAGGTTGA GAGAACATGT TCTCTGAGAT GCCAAATGAA TATGAATCCG TACTACTAAC AATTTCAAAC
TTTTAAATGA GCTAGTTCAG GCATGAATTT TGAAATCTGA TGTATACCTT TTTTTTTTTG CAGTGTGGTG TAGGAGGACA
GATGAGCTTG TAGATGGACC AAATGCCTCG CACATCACAC CGTCAGCCCT GGACCGGTGG GAGAAGAGGC TTGATGATCT
CTTCACCGGA CGCCCCTACG ACATGCTTGA TGCTGCACTT TCTGATACCA TCTCCAAGTT TCCTATAGAT ATTCAGGTAA
CTAGCTGGTA TATGCATATA GCGAAAATCC AAATGATGTA ATACTGCTAG ACTATATTGG TTGCTAATCC CTATGGATTC
CCTGCACATC GCAATTCTAG TGCAAGAAGA ATAGACCTAC TAAGTTGACG ACCAAATAGT TGATCGGTCA ACAATATCAT
ATGACTTGTC AGCCATTAGT CTCTGATGCC ACTGTTAACT TTTCACACAA TTTATTGGGC TTAGTCCAGG ACTCCATGTG
GCCACAATGC ACAGTATTAG TCTAGGAAAA AGATCAATCC AAGGACAGAT ATGGTAGGAC TTTTCAGAAC AGACAACTGA
TAGAGCACAG CCCATCAAGT AGAATACTAA GGGGAAGGCC ATAATTCCTA TGCAATTCTA TGGAGTTGTT AACCTGAATT
AAGCAGGTTC TATACAGAAT AAAAGAACTT GCTCATTATC TATGATGACA AAAAAGGAAG GAAAAGTTCC ACTGAGAATT
TTACTGAACA CATGAAAACC CACAATTGGA AACTTATCAT CTGTCCTTTG AGTTTTTACA GACCACATGG TGTATAATAA
TATGACTAAT CAAATGCAAT GCACGTATGC CAGCCTTTCA GGGACATGAT AGAAGGGATG CGGTCAGACC TCAGAAAGAC
TAGATACAAG AACTTCGACG AGCTCTACAT GTACTGCTAC TATGTTGCTG GAACTGTGGG GCTAATGAGT GTTCCTGTGA
TGGGTATTGC ACCCGAGTCG AAGGCAACAA CTGAAAGTGT GTACAGTGCT GCTTTGGCTC TCGGCATTGC AAACCAGCTC
ACAAATATAC TCCGTGACGT TGGAGAGGAG TAAGTGTCAA TACAGTGGTT TTCACTAATG GTCATAAGCT GTAGAACAGA
ATGTCGGCAT ATATATAGTT CACTGATCCT AATACTTCAT TTTATTTTCA CAGCGCGAGA AGAGGGAGGA TATATTTACC
ACAAGATGAA CTTGCAGAGG CAGGGCTCTC TGATGAGGAC ATCTTCAATG GCGTTGTGAC TAACAAATGG AGAAGCTTCA
TGAAGAGACA GATCAAGAGA GCTAGGATGT TTTTTGAGGA GGCAGAGAGA GGGGTGACCG AGCTCAGCCA GGCAAGCCGG
TGGCCGGTAA GAAGAGTCAC TTGATTCTCA AGGAAACATA AAGCAGATTA TTATTGTCGG TGCTTCTATG CCATGGTGTC
AAAAGGAAAA TAAAATATCA TTGCATTGCC CCGTTGCAGG TCTGGGCGTC TCTGTTGTTA TACCGGCAAA TCCTTGACGA
GATAGAAGCA AACGATTACA ACAACTTCAC AAAGAGGGCG TACGTTGGGA AGGCGAAGAA ATTGCTAGCG CTTCCAGTTG
CATATGGTAG ATCATTGCTG ATGCCCTACT CACTGAGAAA TAGCCAGAAG TAGGAGGCGG GAAGAGGAGA TAAAGGGAAG
ATGATGAGCA GGTTAGGCTT AGATAGGAAA AATCAGACAG CATCTGCCTT CCGATTAATG TTGAGGAAAT TATATTATTG
TGTGTATCAT ACATAGCATG TATAGGGAAA ATGCTGCAGG CAGGCAGGCA GGCTAGGTGA TGGTTGAATA TTTCCTTCAC
ATCATGTATG TATATCCTTC CTTGATGCTA CAGCACATAT GTATGTATGA CTCTGAAGAA AGAGCAACCT GTATAGTAGC
TAACCGGCTA TGGCCTATGT ATGGGCCGCA GAGGTGAGC