Os06t0729000-03

Locus

Os06g0729000

Description

Similar to Phytoene synthase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PSY1

CGSNL Gene Name

PHYTOENE SYNTHASE 1

Oryzabase Gene Symbol Synonym(s)

PSY1, OsPSY1

Oryzabase Gene Name Synonym(s)

phytoene synthase 1, PSY1-like gene

Transcript Evidence

AK059535 (DDBJ, Best hit)

Protein Evidence

A2YH75 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: transferase activity (GO:0016740)

Molecular Function: transferase activity, transferring alkyl or aryl (other than methyl) groups (GO:0016765)

Functional domain (InterPro)

Squalene/phytoene synthase (IPR002060)

Terpenoid synthase (IPR008949)

Squalene/phytoene synthase, conserved site (IPR019845)

Full-length cDNA

001-029-E01 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0729000-03)

RiceXPro (AK059535)

Others

Oryzabase (8086)

KEGG (Os06t0729000-03 (EC:2.5.1.32))

Transcript

1006 bp

>Os06t0729000-03 Similar to Phytoene synthase.
CTAGATACAAGAACTTCGACGAGCTCTACATGTACTGCTACTATGTTGCTGGAACTGTGG
GGCTAATGAGTGTTCCTGTGATGGGTATTGCACCCGAGTCGAAGGCAACAACTGAAAGTG
TGTACAGTGCTGCTTTGGCTCTCGGCATTGCAAACCAGCTCACAAATATACTCCGTGACG
TTGGAGAGGACGCGAGAAGAGGGAGGATATATTTACCACAAGATGAACTTGCAGAGGCAG
GGCTCTCTGATGAGGACATCTTCAATGGCGTTGTGACTAACAAATGGAGAAGCTTCATGA
AGAGACAGATCAAGAGAGCTAGGATGTTTTTTGAGGAGGCAGAGAGAGGGGTGACCGAGC
TCAGCCAGGCAAGCCGGTGGCCGGTAAGAAGAGTCACTTGATTCTCAAGGAAACATAAAG
CAGATTATTATTGTCGGTGCTTCTATGCCATGGTGTCAAAAGGAAAATAAAATATCATTG
CATTGCCCCGTTGCAGGTCTGGGCGTCTCTGTTGTTATACCGGCAAATCCTTGACGAGAT
AGAAGCAAACGATTACAACAACTTCACAAAGAGGGCGTACGTTGGGAAGGCGAAGAAATT
GCTAGCGCTTCCAGTTGCATATGGTAGATCATTGCTGATGCCCTACTCACTGAGAAATAG
CCAGAAGTAGGAGGCGGGAAGAGGAGATAAAGGGAAGATGATGAGCAGGTTAGGCTTAGA
TAGGAAAAATCAGACAGCATCTGCCTTCCGATTAATGTTGAGGAAATTATATTATTGTGT
GTATCATACATAGCATGTATAGGGAAAATGCTGCAGGCAGGCAGGCAGGCTAGGTGATGG
TTGAATATTTCCTTCACATCATGTATGTATATCCTTCCTTGATGCTACAGCACATATGTA
TGTATGACTCTGAAGAAAGAGCAACCTGTATAGTAGCTAACCGGCTATGGCCTATGTATG
GGCCGCAGAGGTGAGCAAACAAAAATCATCATCCATGGATTGATTG

CDS

399 bp

>Os06t0729000-03 Similar to Phytoene synthase.
AGATACAAGAACTTCGACGAGCTCTACATGTACTGCTACTATGTTGCTGGAACTGTGGGG
CTAATGAGTGTTCCTGTGATGGGTATTGCACCCGAGTCGAAGGCAACAACTGAAAGTGTG
TACAGTGCTGCTTTGGCTCTCGGCATTGCAAACCAGCTCACAAATATACTCCGTGACGTT
GGAGAGGACGCGAGAAGAGGGAGGATATATTTACCACAAGATGAACTTGCAGAGGCAGGG
CTCTCTGATGAGGACATCTTCAATGGCGTTGTGACTAACAAATGGAGAAGCTTCATGAAG
AGACAGATCAAGAGAGCTAGGATGTTTTTTGAGGAGGCAGAGAGAGGGGTGACCGAGCTC
AGCCAGGCAAGCCGGTGGCCGGTAAGAAGAGTCACTTGA

Protein

133 aa

>Os06t0729000-03 Similar to Phytoene synthase.
RYKNFDELYMYCYYVAGTVGLMSVPVMGIAPESKATTESVYSAALALGIANQLTNILRDV
GEDARRGRIYLPQDELAEAGLSDEDIFNGVVTNKWRSFMKRQIKRARMFFEEAERGVTEL
SQASRWPVRRVT*

5'UTR

chr06:31053115..31053116 (- strand) : 2 bp

CDS

chr06:31052927..31053114 (- strand) : 188 bp

chr06:31052612..31052822 (- strand) : 211 bp

3'UTR

chr06:31052007..31052611 (- strand) : 605 bp

FASTA

>Os06t0729000-03 class=Sequence position=chr06:31052007..31053116 (- strand)
CTAGATACAA GAACTTCGAC GAGCTCTACA TGTACTGCTA CTATGTTGCT GGAACTGTGG GGCTAATGAG TGTTCCTGTG
ATGGGTATTG CACCCGAGTC GAAGGCAACA ACTGAAAGTG TGTACAGTGC TGCTTTGGCT CTCGGCATTG CAAACCAGCT
CACAAATATA CTCCGTGACG TTGGAGAGGA GTAAGTGTCA ATACAGTGGT TTTCACTAAT GGTCATAAGC TGTAGAACAG
AATGTCGGCA TATATATAGT TCACTGATCC TAATACTTCA TTTTATTTTC ACAGCGCGAG AAGAGGGAGG ATATATTTAC
CACAAGATGA ACTTGCAGAG GCAGGGCTCT CTGATGAGGA CATCTTCAAT GGCGTTGTGA CTAACAAATG GAGAAGCTTC
ATGAAGAGAC AGATCAAGAG AGCTAGGATG TTTTTTGAGG AGGCAGAGAG AGGGGTGACC GAGCTCAGCC AGGCAAGCCG
GTGGCCGGTA AGAAGAGTCA CTTGATTCTC AAGGAAACAT AAAGCAGATT ATTATTGTCG GTGCTTCTAT GCCATGGTGT
CAAAAGGAAA ATAAAATATC ATTGCATTGC CCCGTTGCAG GTCTGGGCGT CTCTGTTGTT ATACCGGCAA ATCCTTGACG
AGATAGAAGC AAACGATTAC AACAACTTCA CAAAGAGGGC GTACGTTGGG AAGGCGAAGA AATTGCTAGC GCTTCCAGTT
GCATATGGTA GATCATTGCT GATGCCCTAC TCACTGAGAA ATAGCCAGAA GTAGGAGGCG GGAAGAGGAG ATAAAGGGAA
GATGATGAGC AGGTTAGGCT TAGATAGGAA AAATCAGACA GCATCTGCCT TCCGATTAAT GTTGAGGAAA TTATATTATT
GTGTGTATCA TACATAGCAT GTATAGGGAA AATGCTGCAG GCAGGCAGGC AGGCTAGGTG ATGGTTGAAT ATTTCCTTCA
CATCATGTAT GTATATCCTT CCTTGATGCT ACAGCACATA TGTATGTATG ACTCTGAAGA AAGAGCAACC TGTATAGTAG
CTAACCGGCT ATGGCCTATG TATGGGCCGC AGAGGTGAGC AAACAAAAAT CATCATCCAT GGATTGATTG