Os06t0729400-01

Locus

Os06g0729400

Description

Similar to Gibberellin-regulated protein 2 precursor.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK059502 (DDBJ, Best hit)

Protein Evidence

NP_001152731.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Gibberellin regulated protein (IPR003854)

Full-length cDNA

001-029-A05 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0729400-01)

RiceXPro (AK059502)

Others

KEGG (Os06t0729400-01)

Transcript

709 bp

>Os06t0729400-01 Similar to Gibberellin-regulated protein 2 precursor.
AGCTAAACCCTGTCCCTTGTTAATTCTTCTTCTTCTTCCTAACTACTCCAAGCTAGCTCA
GAATCAGATCCATCCATGGCCTCCTCCGGCTCCAAGTCCAAGACCAACAATGGCTTCTTC
GTCCCTTCTCCTGCAACTGCAATGGCGCCATGCTTCCTCCTCTTGCTCATCTTCTTCTTC
CTCCATGTCGATGCTTCTGCTGCTGCTGCTTCTTCTTCTTCCCATCCACAGCTGGTGCAG
CAGATGCAGGTGAAGAGGGCGAGATCCCTCCTGCAGGCTCCAAAGATAGACTGCCAGGGG
ACGTGCTCGGGGCGATGCGCCAACAACTGGAAGAAGGAGATGTGCAACAAGATGTGCAAC
GTCTGCTGCAACCGATGCAACTGCGTTCCCCCGGGAAGTGGGCAGGACACCCGCCACCTC
TGCCCTTGCTACGACACCATGGTTAATCCACACAACGGCAAGCTCAAGTGCCCATGATTC
CTTCCTTCCTATTAGCTGCTGCTATTGCTCTCAGAGAGATCAGAGTACAATGTACTTGGT
AGTATGTGTACGTATGTGTTCCATGCATCTTGATGTTCAATCCCTACATCTCTCTGGCTG
TCACTACTAGCTTAGCTACTACATAGGACTGCTCTATATAATAGATGCCTTTCTACTTTC
TTCAATCTCCAGCACCAGGAATAAAACAAACATATCATGATTCTCTTCT

CDS

402 bp

>Os06t0729400-01 Similar to Gibberellin-regulated protein 2 precursor.
ATGGCCTCCTCCGGCTCCAAGTCCAAGACCAACAATGGCTTCTTCGTCCCTTCTCCTGCA
ACTGCAATGGCGCCATGCTTCCTCCTCTTGCTCATCTTCTTCTTCCTCCATGTCGATGCT
TCTGCTGCTGCTGCTTCTTCTTCTTCCCATCCACAGCTGGTGCAGCAGATGCAGGTGAAG
AGGGCGAGATCCCTCCTGCAGGCTCCAAAGATAGACTGCCAGGGGACGTGCTCGGGGCGA
TGCGCCAACAACTGGAAGAAGGAGATGTGCAACAAGATGTGCAACGTCTGCTGCAACCGA
TGCAACTGCGTTCCCCCGGGAAGTGGGCAGGACACCCGCCACCTCTGCCCTTGCTACGAC
ACCATGGTTAATCCACACAACGGCAAGCTCAAGTGCCCATGA

Protein

133 aa

>Os06t0729400-01 Similar to Gibberellin-regulated protein 2 precursor.
MASSGSKSKTNNGFFVPSPATAMAPCFLLLLIFFFLHVDASAAAASSSSHPQLVQQMQVK
RARSLLQAPKIDCQGTCSGRCANNWKKEMCNKMCNVCCNRCNCVPPGSGQDTRHLCPCYD
TMVNPHNGKLKCP*

5'UTR

chr06:31082752..31082826 (+ strand) : 75 bp

CDS

chr06:31082827..31082985 (+ strand) : 159 bp

chr06:31083082..31083136 (+ strand) : 55 bp

chr06:31083221..31083408 (+ strand) : 188 bp

3'UTR

chr06:31083409..31083640 (+ strand) : 232 bp

FASTA

>Os06t0729400-01 class=Sequence position=chr06:31082752..31083640 (+ strand)
AGCTAAACCC TGTCCCTTGT TAATTCTTCT TCTTCTTCCT AACTACTCCA AGCTAGCTCA GAATCAGATC CATCCATGGC
CTCCTCCGGC TCCAAGTCCA AGACCAACAA TGGCTTCTTC GTCCCTTCTC CTGCAACTGC AATGGCGCCA TGCTTCCTCC
TCTTGCTCAT CTTCTTCTTC CTCCATGTCG ATGCTTCTGC TGCTGCTGCT TCTTCTTCTT CCCATCCACA GCTGGTAAGG
AACACAAACA CAAACATACT ACTACTTATC TATATATAGT TCTTGCCTTA ATTTGAACGA CATATATGAT ATGATATGAT
GATGTAGCAG GTGCAGCAGA TGCAGGTGAA GAGGGCGAGA TCCCTCCTGC AGGCTCCAAA GATAGGTATG TAAATGATAC
ATTACAGGCA GGAGAGGAGA GGCGATGGAA TTGTACTAAT AAATTAAAAT GGTACCACTA AATGTATAGA CTGCCAGGGG
ACGTGCTCGG GGCGATGCGC CAACAACTGG AAGAAGGAGA TGTGCAACAA GATGTGCAAC GTCTGCTGCA ACCGATGCAA
CTGCGTTCCC CCGGGAAGTG GGCAGGACAC CCGCCACCTC TGCCCTTGCT ACGACACCAT GGTTAATCCA CACAACGGCA
AGCTCAAGTG CCCATGATTC CTTCCTTCCT ATTAGCTGCT GCTATTGCTC TCAGAGAGAT CAGAGTACAA TGTACTTGGT
AGTATGTGTA CGTATGTGTT CCATGCATCT TGATGTTCAA TCCCTACATC TCTCTGGCTG TCACTACTAG CTTAGCTACT
ACATAGGACT GCTCTATATA ATAGATGCCT TTCTACTTTC TTCAATCTCC AGCACCAGGA ATAAAACAAA CATATCATGA
TTCTCTTCT

Locus: Os06g0729400

Loading...

Locus: Os06g0729400

Loading...