Os07t0108900-01

Locus

Os07g0108900

Description

Similar to MADS-box transcription factor 15.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RAP1A

CGSNL Gene Name

RICE APETALA 1A

Oryzabase Gene Symbol Synonym(s)

OsMADS15, FDRMADS3, RMADS215, MADS15, DEP

Oryzabase Gene Name Synonym(s)

MADS-box transcription factor 15, Protein APETALA1-like A, degenerative palea, MADS box gene15

Transcript Evidence

AK072683 (DDBJ, Best hit)

Protein Evidence

Q6Q9I2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

Transcription factor, MADS-box (IPR002100)

Full-length cDNA

J023140K24 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0108900-01)

RiceXPro (AK072683)

Others

Oryzabase (8430)

KEGG (Os07t0108900-01)

Transcript

2562 bp

>Os07t0108900-01 Similar to MADS-box transcription factor 15.
ACTGACACCCGTCCCCAAAAGCAAAGAGGCCTCTCTCTCTCTCTCTCGCCGATCCCTCTC
CTCCTCCTCTTCTTCTTCTTCCACTAGCTAGTTCGTCTTCCTCCTTCAGCTAGCTTGTAG
CAGCTAAGGTTAGGTCGGATCGAGATCGGGATCGGCCGCCGGCGAGCGGCGAGCGGCGAG
GATGGGGCGGGGGAAGGTGCAGCTGAAGCGGATAGAGAACAAGATCAACAGGCAGGTGAC
GTTCTCCAAGAGGAGGAATGGATTGCTGAAGAAGGCGCACGAGATCTCCGTCCTCTGCGA
CGCCGAGGTCGCCGCCATCGTCTTCTCCCCCAAGGGCAAGCTCTACGAGTACGCCACTGA
CTCCAGGATGGACAAAATCCTTGAACGTTATGAGCGCTATTCATATGCTGAAAAGGCTCT
TATTTCAGCTGAATCCGAGAGTGAGGTAAAACACAGTAGGTTGTATGATATATAACTTTT
ACATGAAGGGAATATTATTGTTCCTTTTCTATTGCATTAGCATTTCAATCATATCATTTC
CTTGTGGCCTTTTAAATCACATGTTAACAAAGCAGTTTTTCTGAATTCTATCGTTCTACT
TGCCAAAACTAGATGTTGGTAACCTTCTGTTTTATACTTTTTAACTTCAAACCTCGTGTC
TTTTGCACTCTGGCATATTTCTTAAAATTTCTACTTATTGGGATATCATGCAGGAGAGTC
CTCATTCCCTTCATTTAATCCCCTCAAATTTTATTTATTATGGTCATACAATTAATGGGC
CACATGCATGGAAGTCGATCGCCAGCTTGCGATCAGCATCCTATCATTAATGTTATGATC
TATACTAATTCTTCTGTAAATAAATTAAAATTGCACTAGTTTTTAACTAAATGCTACTAT
TCTATTTTTTTATCCATACTCCGTTTGAGTGGTTTCTTTTGTGTTTCATGAAGCAATATA
ATATGCTTAAGAAAACATAGAAACATGCACAATACAATAATAGCGCTGGTAGAATCCGGT
TGGAGACCAAATGTTTCGATATTCTAAGTGCATATTTATATATACTAAGTAAAACTGTAA
TCATAAACATGCATATGGACTGTGATCGATGAAATGTTTCTTCATTTTTTTTTTCAAGAT
AACTCTTCCCCAGTTGACAACATGCACTGCATCCAGAAGTACTCATGGTATTTGTTTTCA
GTACTGTTTGATGAGTAAAACTTTGGTAAGTGTTAAAAAATGATGATAAGTGCAAATATT
TGTTCCTTTACCACTTCCACCTTCTTGGAGTAAAGAAAAAAATGTGTGTGGTTTGGCAAA
GTTGTTGCATATATCACGGCATTAGTGTGCGGATAATGCGAATAAATGCATCAATAAGCA
CTAGGAGTAAGTTAATTAGTTCTCTACCTTAATTGAAAAGTTCATGTACATTTAAAAAAA
TTAAACATGCCTCTTTTTATCATTTGTTGAATTTCTACATTTATCAAGACAGCAAAGGAG
TTCTCATCTACTAATAAATTAATTTAAGGAGCTATAACTCCCTTAATTTTATCAAATATT
CACATACACGGTTGCATTTGAGGATTTTCTATATACTCCACTAAATGAGGATGCATTTAG
GTTCTTTATAATATTTTATTTCCATCGTTTCATCATCTGTTTATGTTTACAGTAATTTAG
TAATAGTTCTCTAATTTTGACAGTAATGGTTGGCTCACAGAAAACATCAACCAACCATAT
ATATTGGTTTATACTGACAAAGAGTTTTTTTTTGTACAGGGAAATTGGTGCCATGAATAC
AGGAAACTTAAGGCAAAGATTGAGACCATACAAAAATGTCACAAACACCTCATGGGAGAG
GATCTAGAATCCCTGAATCTCAAAGAACTCCAACAGCTAGAGCAGCAGCTGGAGAGTTCA
TTGAAGCACATAATATCAAGAAAGAGCCACCTTATGCTTGAGTCCATTTCCGAGCTGCAG
AAAAAGGAGAGGTCACTGCAGGAGGAGAACAAGGCTCTGCAGAAGGAACTGGTGGAGAGG
CAGAAGAATGTGAGGGGCCAGCAGCAAGTAGGGCAGTGGGACCAAACCCAGGTCCAGGCC
CAGGCCCAAGCCCAACCCCAAGCCCAGACAAGCTCCTCCTCCTCCTCCATGCTGAGGGAT
CAGCAGGCACTTCTTCCACCACAAAATATCTGCTACCCGCCGGTGATGATGGGCGAGAGA
AATGATGCGGCGGCGGCGGCGGCGGTGGCGGCGCAGGGCCAGGTGCAACTCCGCATCGGA
GGTCTTCCGCCATGGATGCTGAGCCACCTCAATGCTTAAGATGATCATCGTCGTCGTCGT
CGGCCAAACAGCTGCCGTATGCACCGTGAATCATGGGAGCAACCTTGAATGAATTGAAGT
CATTGGTATCGATCCTAGCGATAATATATATGATTCTCCTAAAATGAAATTGATCTCAAA
AAAACAAACCTAGCGATTAAGCTATTCTTATATATGTGTTTGCCTGCTGCCCCCTACCCT
ACAGGCTACATATGATTTGCAAGAAATTAATTATGAGCAAGG

CDS

294 bp

>Os07t0108900-01 Similar to MADS-box transcription factor 15.
ATGGGGCGGGGGAAGGTGCAGCTGAAGCGGATAGAGAACAAGATCAACAGGCAGGTGACG
TTCTCCAAGAGGAGGAATGGATTGCTGAAGAAGGCGCACGAGATCTCCGTCCTCTGCGAC
GCCGAGGTCGCCGCCATCGTCTTCTCCCCCAAGGGCAAGCTCTACGAGTACGCCACTGAC
TCCAGGATGGACAAAATCCTTGAACGTTATGAGCGCTATTCATATGCTGAAAAGGCTCTT
ATTTCAGCTGAATCCGAGAGTGAGGTAAAACACAGTAGGTTGTATGATATATAA

Protein

97 aa

>Os07t0108900-01 Similar to MADS-box transcription factor 15.
MGRGKVQLKRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAAIVFSPKGKLYEYATD
SRMDKILERYERYSYAEKALISAESESEVKHSRLYDI*

5'UTR

chr07:477475..477655 (- strand) : 181 bp

CDS

chr07:477290..477474 (- strand) : 185 bp

chr07:474765..474873 (- strand) : 109 bp

3'UTR

chr07:473396..474764 (- strand) : 1369 bp

chr07:473147..473246 (- strand) : 100 bp

chr07:472730..472771 (- strand) : 42 bp

chr07:472552..472593 (- strand) : 42 bp

chr07:471877..472040 (- strand) : 164 bp

chr07:471352..471721 (- strand) : 370 bp

FASTA

>Os07t0108900-01 class=Sequence position=chr07:471352..477655 (- strand)
ACTGACACCC GTCCCCAAAA GCAAAGAGGC CTCTCTCTCT CTCTCTCGCC GATCCCTCTC CTCCTCCTCT TCTTCTTCTT
CCACTAGCTA GTTCGTCTTC CTCCTTCAGC TAGCTTGTAG CAGCTAAGGT TAGGTCGGAT CGAGATCGGG ATCGGCCGCC
GGCGAGCGGC GAGCGGCGAG GATGGGGCGG GGGAAGGTGC AGCTGAAGCG GATAGAGAAC AAGATCAACA GGCAGGTGAC
GTTCTCCAAG AGGAGGAATG GATTGCTGAA GAAGGCGCAC GAGATCTCCG TCCTCTGCGA CGCCGAGGTC GCCGCCATCG
TCTTCTCCCC CAAGGGCAAG CTCTACGAGT ACGCCACTGA CTCCAGGTAC ACCTATAGCC TGATCGATTC CTTGCCATTT
CTGGAGCACC TGAGCCCGCC TGAGATGGAT GAACTCAATA ATTCTCCTAG CTTTTTGCCG TTTCTGGCCG GCCGCTTCCA
TGGATTTCAG CTGCTGCTCT CTGAATTTGC CATGTTTGGT TTGTGCATCT GGTTGCATGT GTGCTACAGC TGATGATTTT
ATGCTTCACT AGTGCTGCAA CACATGCAAC ACAGTCCAAT CCAAGCTAGC TCAGCTACTC CAGGAGGAGG AGTCAGCTGC
ATGCCTCCTC ATTTCGGGAA ATCATCTCTC TCTCTTTCTA TTTTTTCCCT TTCCTTTCTT GTTTCCCCTT TTTCTTTCCT
GCTAGCTTGC TTCTCTCTCT ACACCCTGCA TACCCTTTTT GGGATTGATG GCCGGTTTTA ATTAATTTCC CCTCCTTTCT
TTAGTTAATT ACTACCCTAC TACTAATTCA TCTCCTCCCG ATCCTCTCAA TTTCTCATCA TATGGAGTAC TACTAAAATA
TATATATGTA GTACGCACTT GGTGTGGCCG GTCTTTGTTA ACATCATGTG CTTGCTTAGA TTCAAGGGGA TTATATATAT
AAGAGGATCT ACTACTAAGT GTACTTTGTG ATTACATCAG CTATCTATGT AGCTGATGAT CTTGCTTTGG TCTTTTGCTG
ATCCATTGAG CTAGTGCTAA TTCTCATCAC CCTTCCATTT GATGTACTGC AAATAGTTTT TTATTCATTC GCTTCTTCTC
CCTCTTCCCC ATGTGATTTG ATTGCTAGCT CCTTCCTGAC TTTTATTTGG GTTGATTTCG TCACATCTTC CTCTCAAATT
AATCTCATGC GCGTGCCTTT GTTCTCCACC TGTCAAGAAA TTAATTAAAG AATATATCAC ACGAATTACG AGGAGTCCAC
CACCAGTGTC ATGCACTCCT CCCTATTGTT CACAGTCACA GCTGATGCAT GCAAAACATC TTCTGTTTCT CAAGTAATTA
ATTCCCCTCT TCTTGTGAGG CTTGGCTTAA AATTACTCAA ACAGCTGTTT TTCTTGCTTA TGCATCATCT TCCTCAGATA
CCAAAACGTT GGAGATGGAC AGATCTGGCC TTTCCTCTTC CCTTCTCTCT CATCCTCTTC TATGTTTCTG CCTCTTCTTA
TGATGAATCT TTATTTGGTA TTATTCACGT TAAGCATCTC TTTAAAGAGC CCTAGATCAA ATTTGATCTA TCTCTTTTGG
TTTAACTTCA TGGCCAGTTG CTTGTGTGTT TTGGTCTAGA ACGACCACGT ACGCGAGATA TTTCCTTTTC TGCTCAGCTG
ATTAATTAAT AATGATGGGA TAATTCACTA ATTATTCTGG AGTTAGATCA AGAGATGTAC TTAAACATCC TGTGACACGA
TGACTTCAAA AAATAATCTT GCTCTCTGTA AAATCACATA ATAGCTAGCC ATCGCGCGTG TTTCAGAAAA ATAATTTATC
TTGCTTGCTA GCTTTTGCTC AAAATGCGTT TCTGACGTCT AGGTAAAGAG GACTTTTACG GTCGTCTGTG TTGTACTGGA
ACAGTGCCCT GCACACTCCC CAGCGTCAAG ATCAGTCTAA GGCGCTTCAT TTCTAGCTCA GAAATCTTCA CTTATTTGAT
CTTAATTATA GATCTTCCTG AGATAGATCT AAGGGTGTTC CAGTAAAACA GAAGAAGTCA AGTTCTTCAG GATCCTCGTG
ATATAATTAA ACTGTAGTCT CACAATCTTA CTGATCATCA AGGAGTCTGT AAACACCTAT ACGTACGGCT ATAGGATTAT
GGGGAGGTTG GTCTAAAATA AAGGTGTTAA ATTACTTGCA ATTATCAAGA TGTGCAAATC ATCACCCAGT AATTCAATGG
TGCTATTATA TATAGTCTGT TTTGAACAGT TCCACTGGTT TTGTTAGGGT CCTTGCTGAT GGCTGTTTAA CGGTGCTGTT
ATATATAATC TTGATTATTT TTTTTGCTAA ATTTTCCTAA GCAACCCACT TCAAATTTTG GAATGGGTGA ATTCTTATGT
TCACACCCTC ATATCACATG TGTCATGAGG AGCTTTTTTT TCGTCACACA GTCCCATACA ACGTCCCTGT TTTCTTGAAG
ATAAGATAAT TCATGCATGC ACTTGAATAT AACCGAGTGT TTTCATGTGC ATGCTTTTTA TTTGGCTGTG TCGAGTGTTT
AGACAGCAAA AGAGCTCTTG TGCATACAAA TGCCGATATC TATATATTAG TAGTCTTAAT CCACATTTCA GCTTTAATTG
CTTGGAATAG TTTGGTAGGC ATTCCTAGCT TCAGACCATT TAAATATACT TCCTAAACGT TGTCATGAGA ATGCTGAATG
CAAAGTATTT ACATATATAG TGGACTAATT TCAGATTCTG CTCATGATGG TTTTCCCTGC AGGATGGACA AAATCCTTGA
ACGTTATGAG CGCTATTCAT ATGCTGAAAA GGCTCTTATT TCAGCTGAAT CCGAGAGTGA GGTAAAACAC AGTAGGTTGT
ATGATATATA ACTTTTACAT GAAGGGAATA TTATTGTTCC TTTTCTATTG CATTAGCATT TCAATCATAT CATTTCCTTG
TGGCCTTTTA AATCACATGT TAACAAAGCA GTTTTTCTGA ATTCTATCGT TCTACTTGCC AAAACTAGAT GTTGGTAACC
TTCTGTTTTA TACTTTTTAA CTTCAAACCT CGTGTCTTTT GCACTCTGGC ATATTTCTTA AAATTTCTAC TTATTGGGAT
ATCATGCAGG AGAGTCCTCA TTCCCTTCAT TTAATCCCCT CAAATTTTAT TTATTATGGT CATACAATTA ATGGGCCACA
TGCATGGAAG TCGATCGCCA GCTTGCGATC AGCATCCTAT CATTAATGTT ATGATCTATA CTAATTCTTC TGTAAATAAA
TTAAAATTGC ACTAGTTTTT AACTAAATGC TACTATTCTA TTTTTTTATC CATACTCCGT TTGAGTGGTT TCTTTTGTGT
TTCATGAAGC AATATAATAT GCTTAAGAAA ACATAGAAAC ATGCACAATA CAATAATAGC GCTGGTAGAA TCCGGTTGGA
GACCAAATGT TTCGATATTC TAAGTGCATA TTTATATATA CTAAGTAAAA CTGTAATCAT AAACATGCAT ATGGACTGTG
ATCGATGAAA TGTTTCTTCA TTTTTTTTTT CAAGATAACT CTTCCCCAGT TGACAACATG CACTGCATCC AGAAGTACTC
ATGGTATTTG TTTTCAGTAC TGTTTGATGA GTAAAACTTT GGTAAGTGTT AAAAAATGAT GATAAGTGCA AATATTTGTT
CCTTTACCAC TTCCACCTTC TTGGAGTAAA GAAAAAAATG TGTGTGGTTT GGCAAAGTTG TTGCATATAT CACGGCATTA
GTGTGCGGAT AATGCGAATA AATGCATCAA TAAGCACTAG GAGTAAGTTA ATTAGTTCTC TACCTTAATT GAAAAGTTCA
TGTACATTTA AAAAAATTAA ACATGCCTCT TTTTATCATT TGTTGAATTT CTACATTTAT CAAGACAGCA AAGGAGTTCT
CATCTACTAA TAAATTAATT TAAGGAGCTA TAACTCCCTT AATTTTATCA AATATTCACA TACACGGTTG CATTTGAGGA
TTTTCTATAT ACTCCACTAA ATGAGGATGC ATTTAGGTTC TTTATAATAT TTTATTTCCA TCGTTTCATC ATCTGTTTAT
GTTTACAGTA ATTTAGTAAT AGTTCTCTAA TTTTGACAGT AATGGTTGGC TCACAGAAAA CATCAACCAA CCATATATAT
TGGTTTATAC TGACAAAGAG TTTTTTTTTG TACAGGGAAA TTGGTGCCAT GAATACAGGA AACTTAAGGC AAAGATTGAG
ACCATACAAA AATGTCACAA GTAATCGATA TATATATCCA ATTTCTATAA TAATGTTAAA TAAATTTCGA ACTAATTGCA
CTAATTATTA TTTTTAAACC AATTTAAAAG AGAACTTCCG GTATTGACTG CTGAAGATGA CGTGAAACTA ACTTATGTAT
CTTGTGTAGA CACCTCATGG GAGAGGATCT AGAATCCCTG AATCTCAAAG AACTCCAACA GCTAGAGCAG CAGCTGGAGA
GTTCATTGAA GCACATAATA TCAAGAAAGG TAGTATTTTT TTGGATAGTG GAATCTTTTT ATTTGAACTC CCGACCTCTA
CACACCAAAT GTACAGAAAA AAAGGAGCAA ATTATTAAAA GAAACGTAGT AATATATTTA GCATGTTCTG TTTCAAACTG
GACTGAATTG AAATAATTCA TGCATGCGCA TGCCTGAGTT ACATAAATAT ATATCCAAAT GTCTTGTTGT CACTGCTACT
TTGAAACAAA TGTTCTTTTT TTTTTCCTTT TTGAGAAAAT ATATGAGTAA ATATTTTCAG CACATTCTGG AGGAACAATT
ACCAAATATA AACTTTTTAG CACATTCTGG AGTACAATTA CCAAATATGA CGGACTAACT AGAACAATAT GTTTGTGTTT
GCAGAGCCAC CTTATGCTTG AGTCCATTTC CGAGCTGCAG AAAAAGGTGA CCAATTGAAC TGCACTACTG TGTATGCATG
TATATATGAA TCGTGCATGC AAACCGTTGT TAGCTAGTAG TTAGTTATAG TTTACTCTTG GTTAGTCTCA ACTGATAGTG
CAGTTTTCTT GCATGAGTGC AGGAGAGGTC ACTGCAGGAG GAGAACAAGG CTCTGCAGAA GGAAGTAAGT TGTCGAAAAT
ATAGTATTTA CTGCTGCTTA TATTAATTAA TTCATTCTGC TTGACTAGCC AATGGAGGCA CTAAACATAA TTAATTCATG
CGCATTGGTT TTGATCAATT GATTTATCTT GTTGACAATT TTCCAATCTA TCCATGGGTT TAATTACTAG TTTTGTCAAT
GGAGGCATTA GAGATAATTA ATTCATATGC GCACTCGAAA GTTTGAAATT GCTGTAGTTT ACTTGTTGGG TGGATCATAT
CGCCAATAAT TTTTTCCCCC ACAGTTGACC GCAAATGAGA AGTAATTTTC TTTGCCTTCT AGACTTGACG GCTATTTTTT
TAGCGTGTTG GCAATTGAAC ATATGACCTT GGGTTAAAAC CACACATCTT TTATCATTGC GCTATCAAAT ACATCTCGAT
AAATTTGTCC CTTACTAGCG GTTTATGTGG TTTCCTTGGT GGTCGGTTTG TGCCTCTTAG AAAAAAATCG TGATGTTTGT
AGTGTGCGCA TGCAGCTGGT GGAGAGGCAG AAGAATGTGA GGGGCCAGCA GCAAGTAGGG CAGTGGGACC AAACCCAGGT
CCAGGCCCAG GCCCAAGCCC AACCCCAAGC CCAGACAAGC TCCTCCTCCT CCTCCATGCT GAGGGATCAG CAGGCACTTC
TTCCACCACA AAATATCTGG TACGTATATG TCTGCATTCA TGTCTCATCA GTTGCTATTC AGTTATAAAT TAATCTGTTA
CTGCACTAAT TAAGATCGAT CACACCCTTG TTAAGTTCTA AGTCTCTAAT TAATTAACTG CATGTATATA ATTATGCACA
TCTGTGCATA GTAGCTACCC GCCGGTGATG ATGGGCGAGA GAAATGATGC GGCGGCGGCG GCGGCGGTGG CGGCGCAGGG
CCAGGTGCAA CTCCGCATCG GAGGTCTTCC GCCATGGATG CTGAGCCACC TCAATGCTTA AGATGATCAT CGTCGTCGTC
GTCGGCCAAA CAGCTGCCGT ATGCACCGTG AATCATGGGA GCAACCTTGA ATGAATTGAA GTCATTGGTA TCGATCCTAG
CGATAATATA TATGATTCTC CTAAAATGAA ATTGATCTCA AAAAAACAAA CCTAGCGATT AAGCTATTCT TATATATGTG
TTTGCCTGCT GCCCCCTACC CTACAGGCTA CATATGATTT GCAAGAAATT AATTATGAGC AAGG

Locus: Os07g0108900

Loading...

Locus: Os07g0108900

Loading...