Os07t0108900-02

Locus

Os07g0108900

Description

APETALA1 (AP1)/ FRUITFULL (FUL)-like MADS box transcription factor, Specification of inflorescence meristem identity, sexual reproduction

RAP-DB Gene Symbol Synonym(s)

DEP, FDRMADS3, MADS15, OsMADS15, RAP1A, RMADS215

RAP-DB Gene Name Synonym(s)

Degenerative palea, MADS BOX GENE 15, MADS box gene15, MADS-box transcription factor 15, Protein APETALA1-like A, RICE APETALA 1A

CGSNL Gene Symbol

RAP1A

CGSNL Gene Name

RICE APETALA 1A

Oryzabase Gene Symbol Synonym(s)

OsMADS15, FDRMADS3, RMADS215, MADS15, DEP

Oryzabase Gene Name Synonym(s)

MADS-box transcription factor 15, Protein APETALA1-like A, degenerative palea, MADS box gene15

Transcript Evidence

AB003325

Protein Evidence

Q6Q9I2

Literature

PMID: 10382970

PMID: 20107517

PMID: 22570445

Note

Manual Curation

September 5, 2014

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: protein dimerization activity (GO:0046983)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Transcription factor, MADS-box (IPR002100)

Transcription factor, K-box (IPR002487)

Others

Oryzabase (8430)

Transcript

1289 bp

>Os07t0108900-02 APETALA1 (AP1)/ FRUITFULL (FUL)-like MADS box transcription factor, Specification of inflorescence meristem identity, sexual reproduction
CTCCTCCTCCTCTTCTTCTTCTTCCACTAGCTAGTTCGTCTTCCTCCTTCAGCTAGCTTG
TAGCAGCTAAGGTTAGGTCGGATCGAGATCGGGATCGGCCGCCGGCGAGCGGCGAGCGGC
GAGGATGGGGCGGGGGAAGGTGCAGCTGAAGCGGATAGAGAACAAGATCAACAGGCAGGT
GACGTTCTCCAAGAGGAGGAATGGATTGCTGAAGAAGGCGCACGAGATCTCCGTCCTCTG
CGACGCCGAGGTCGCCGCCATCGTCTTCTCCCCCAAGGGCAAGCTCTACGAGTACGCCAC
TGACTCCAGGATGGACAAAATCCTTGAACGTTATGAGCGCTATTCATATGCTGAAAAGGC
TCTTATTTCAGCTGAATCCGAGAGTGAGGGAAATTGGTGCCATGAATACAGGAAACTTAA
GGCAAAGATTGAGACCATACAAAAATGTCACAAACACCTCATGGGAGAGGATCTAGAATC
CCTGAATCTCAAAGAACTCCAACAGCTAGAGCAGCAGCTGGAGAGTTCATTGAAGCACAT
AATATCAAGAAAGAGCCACCTTATGCTTGAGTCCATTTCCGAGCTGCAGAAAAAGGAGAG
GTCACTGCAGGAGGAGAACAAGGCTCTGCAGAAGGAACTGGTGGAGAGGCAGAAGAATGT
GAGGGGCCAGCAGCAAGTAGGGCAGTGGGACCAAACCCAGGTCCAGGCCCAGGCCCAAGC
CCAACCCCAAGCCCAGACAAGCTCCTCCTCCTCCTCCATGCTGAGGGATCAGCAGGCACT
TCTTCCACCACAAAATATCTGCTACCCGCCGGTGATGATGGGCGAGAGAAATGATGCGGC
GGCGGCGGCGGCGGTGGCGGCGCAGGGCCAGGTGCAACTCCGCATCGGAGGTCTTCCGCC
ATGGATGCTGAGCCACCTCAATGCTTAAGATGATCATCGTCGTCGTCGTCGGCCAAACAG
CTGCCGTATGCACCGTGAATCATGGGAGCAACCTTGAATGAATTGAAGTCATTGGTATCG
ATCCTAGCGATAATATATATGATTCTCCTAAAATGAAATTGATCTCAAAAAAACAAACCT
AGCGATTAAGCTATTCTTATATATGTGTTTGCCTGCTGCCCCCTACCCTACAGGCTACAT
ATGATTTGCAAGAAATTAATTATGAGCAAGGATCAGGATGTGTCTTTGTGTAATCATCAG
CACGTACCTAGTGCTTCCTACTGATATATATGCATGCAATTGTGTGCATATAAATATATT
TGCATGCCATGCTCCCGTGATGGTTAATT

CDS

804 bp

>Os07t0108900-02 APETALA1 (AP1)/ FRUITFULL (FUL)-like MADS box transcription factor, Specification of inflorescence meristem identity, sexual reproduction
ATGGGGCGGGGGAAGGTGCAGCTGAAGCGGATAGAGAACAAGATCAACAGGCAGGTGACG
TTCTCCAAGAGGAGGAATGGATTGCTGAAGAAGGCGCACGAGATCTCCGTCCTCTGCGAC
GCCGAGGTCGCCGCCATCGTCTTCTCCCCCAAGGGCAAGCTCTACGAGTACGCCACTGAC
TCCAGGATGGACAAAATCCTTGAACGTTATGAGCGCTATTCATATGCTGAAAAGGCTCTT
ATTTCAGCTGAATCCGAGAGTGAGGGAAATTGGTGCCATGAATACAGGAAACTTAAGGCA
AAGATTGAGACCATACAAAAATGTCACAAACACCTCATGGGAGAGGATCTAGAATCCCTG
AATCTCAAAGAACTCCAACAGCTAGAGCAGCAGCTGGAGAGTTCATTGAAGCACATAATA
TCAAGAAAGAGCCACCTTATGCTTGAGTCCATTTCCGAGCTGCAGAAAAAGGAGAGGTCA
CTGCAGGAGGAGAACAAGGCTCTGCAGAAGGAACTGGTGGAGAGGCAGAAGAATGTGAGG
GGCCAGCAGCAAGTAGGGCAGTGGGACCAAACCCAGGTCCAGGCCCAGGCCCAAGCCCAA
CCCCAAGCCCAGACAAGCTCCTCCTCCTCCTCCATGCTGAGGGATCAGCAGGCACTTCTT
CCACCACAAAATATCTGCTACCCGCCGGTGATGATGGGCGAGAGAAATGATGCGGCGGCG
GCGGCGGCGGTGGCGGCGCAGGGCCAGGTGCAACTCCGCATCGGAGGTCTTCCGCCATGG
ATGCTGAGCCACCTCAATGCTTAA

Protein

267 aa

>Os07t0108900-02 APETALA1 (AP1)/ FRUITFULL (FUL)-like MADS box transcription factor, Specification of inflorescence meristem identity, sexual reproduction
MGRGKVQLKRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAAIVFSPKGKLYEYATD
SRMDKILERYERYSYAEKALISAESESEGNWCHEYRKLKAKIETIQKCHKHLMGEDLESL
NLKELQQLEQQLESSLKHIISRKSHLMLESISELQKKERSLQEENKALQKELVERQKNVR
GQQQVGQWDQTQVQAQAQAQPQAQTSSSSSSMLRDQQALLPPQNICYPPVMMGERNDAAA
AAAVAAQGQVQLRIGGLPPWMLSHLNA*

5'UTR

chr07:477475..477598 (- strand) : 124 bp

CDS

chr07:477290..477474 (- strand) : 185 bp

chr07:474795..474873 (- strand) : 79 bp

chr07:473396..473460 (- strand) : 65 bp

chr07:473147..473246 (- strand) : 100 bp

chr07:472730..472771 (- strand) : 42 bp

chr07:472552..472593 (- strand) : 42 bp

chr07:471877..472040 (- strand) : 164 bp

chr07:471595..471721 (- strand) : 127 bp

3'UTR

chr07:471234..471594 (- strand) : 361 bp

FASTA

>Os07t0108900-02 class=Sequence position=chr07:471234..477598 (- strand)
CTCCTCCTCC TCTTCTTCTT CTTCCACTAG CTAGTTCGTC TTCCTCCTTC AGCTAGCTTG TAGCAGCTAA GGTTAGGTCG
GATCGAGATC GGGATCGGCC GCCGGCGAGC GGCGAGCGGC GAGGATGGGG CGGGGGAAGG TGCAGCTGAA GCGGATAGAG
AACAAGATCA ACAGGCAGGT GACGTTCTCC AAGAGGAGGA ATGGATTGCT GAAGAAGGCG CACGAGATCT CCGTCCTCTG
CGACGCCGAG GTCGCCGCCA TCGTCTTCTC CCCCAAGGGC AAGCTCTACG AGTACGCCAC TGACTCCAGG TACACCTATA
GCCTGATCGA TTCCTTGCCA TTTCTGGAGC ACCTGAGCCC GCCTGAGATG GATGAACTCA ATAATTCTCC TAGCTTTTTG
CCGTTTCTGG CCGGCCGCTT CCATGGATTT CAGCTGCTGC TCTCTGAATT TGCCATGTTT GGTTTGTGCA TCTGGTTGCA
TGTGTGCTAC AGCTGATGAT TTTATGCTTC ACTAGTGCTG CAACACATGC AACACAGTCC AATCCAAGCT AGCTCAGCTA
CTCCAGGAGG AGGAGTCAGC TGCATGCCTC CTCATTTCGG GAAATCATCT CTCTCTCTTT CTATTTTTTC CCTTTCCTTT
CTTGTTTCCC CTTTTTCTTT CCTGCTAGCT TGCTTCTCTC TCTACACCCT GCATACCCTT TTTGGGATTG ATGGCCGGTT
TTAATTAATT TCCCCTCCTT TCTTTAGTTA ATTACTACCC TACTACTAAT TCATCTCCTC CCGATCCTCT CAATTTCTCA
TCATATGGAG TACTACTAAA ATATATATAT GTAGTACGCA CTTGGTGTGG CCGGTCTTTG TTAACATCAT GTGCTTGCTT
AGATTCAAGG GGATTATATA TATAAGAGGA TCTACTACTA AGTGTACTTT GTGATTACAT CAGCTATCTA TGTAGCTGAT
GATCTTGCTT TGGTCTTTTG CTGATCCATT GAGCTAGTGC TAATTCTCAT CACCCTTCCA TTTGATGTAC TGCAAATAGT
TTTTTATTCA TTCGCTTCTT CTCCCTCTTC CCCATGTGAT TTGATTGCTA GCTCCTTCCT GACTTTTATT TGGGTTGATT
TCGTCACATC TTCCTCTCAA ATTAATCTCA TGCGCGTGCC TTTGTTCTCC ACCTGTCAAG AAATTAATTA AAGAATATAT
CACACGAATT ACGAGGAGTC CACCACCAGT GTCATGCACT CCTCCCTATT GTTCACAGTC ACAGCTGATG CATGCAAAAC
ATCTTCTGTT TCTCAAGTAA TTAATTCCCC TCTTCTTGTG AGGCTTGGCT TAAAATTACT CAAACAGCTG TTTTTCTTGC
TTATGCATCA TCTTCCTCAG ATACCAAAAC GTTGGAGATG GACAGATCTG GCCTTTCCTC TTCCCTTCTC TCTCATCCTC
TTCTATGTTT CTGCCTCTTC TTATGATGAA TCTTTATTTG GTATTATTCA CGTTAAGCAT CTCTTTAAAG AGCCCTAGAT
CAAATTTGAT CTATCTCTTT TGGTTTAACT TCATGGCCAG TTGCTTGTGT GTTTTGGTCT AGAACGACCA CGTACGCGAG
ATATTTCCTT TTCTGCTCAG CTGATTAATT AATAATGATG GGATAATTCA CTAATTATTC TGGAGTTAGA TCAAGAGATG
TACTTAAACA TCCTGTGACA CGATGACTTC AAAAAATAAT CTTGCTCTCT GTAAAATCAC ATAATAGCTA GCCATCGCGC
GTGTTTCAGA AAAATAATTT ATCTTGCTTG CTAGCTTTTG CTCAAAATGC GTTTCTGACG TCTAGGTAAA GAGGACTTTT
ACGGTCGTCT GTGTTGTACT GGAACAGTGC CCTGCACACT CCCCAGCGTC AAGATCAGTC TAAGGCGCTT CATTTCTAGC
TCAGAAATCT TCACTTATTT GATCTTAATT ATAGATCTTC CTGAGATAGA TCTAAGGGTG TTCCAGTAAA ACAGAAGAAG
TCAAGTTCTT CAGGATCCTC GTGATATAAT TAAACTGTAG TCTCACAATC TTACTGATCA TCAAGGAGTC TGTAAACACC
TATACGTACG GCTATAGGAT TATGGGGAGG TTGGTCTAAA ATAAAGGTGT TAAATTACTT GCAATTATCA AGATGTGCAA
ATCATCACCC AGTAATTCAA TGGTGCTATT ATATATAGTC TGTTTTGAAC AGTTCCACTG GTTTTGTTAG GGTCCTTGCT
GATGGCTGTT TAACGGTGCT GTTATATATA ATCTTGATTA TTTTTTTTGC TAAATTTTCC TAAGCAACCC ACTTCAAATT
TTGGAATGGG TGAATTCTTA TGTTCACACC CTCATATCAC ATGTGTCATG AGGAGCTTTT TTTTCGTCAC ACAGTCCCAT
ACAACGTCCC TGTTTTCTTG AAGATAAGAT AATTCATGCA TGCACTTGAA TATAACCGAG TGTTTTCATG TGCATGCTTT
TTATTTGGCT GTGTCGAGTG TTTAGACAGC AAAAGAGCTC TTGTGCATAC AAATGCCGAT ATCTATATAT TAGTAGTCTT
AATCCACATT TCAGCTTTAA TTGCTTGGAA TAGTTTGGTA GGCATTCCTA GCTTCAGACC ATTTAAATAT ACTTCCTAAA
CGTTGTCATG AGAATGCTGA ATGCAAAGTA TTTACATATA TAGTGGACTA ATTTCAGATT CTGCTCATGA TGGTTTTCCC
TGCAGGATGG ACAAAATCCT TGAACGTTAT GAGCGCTATT CATATGCTGA AAAGGCTCTT ATTTCAGCTG AATCCGAGAG
TGAGGTAAAA CACAGTAGGT TGTATGATAT ATAACTTTTA CATGAAGGGA ATATTATTGT TCCTTTTCTA TTGCATTAGC
ATTTCAATCA TATCATTTCC TTGTGGCCTT TTAAATCACA TGTTAACAAA GCAGTTTTTC TGAATTCTAT CGTTCTACTT
GCCAAAACTA GATGTTGGTA ACCTTCTGTT TTATACTTTT TAACTTCAAA CCTCGTGTCT TTTGCACTCT GGCATATTTC
TTAAAATTTC TACTTATTGG GATATCATGC AGGAGAGTCC TCATTCCCTT CATTTAATCC CCTCAAATTT TATTTATTAT
GGTCATACAA TTAATGGGCC ACATGCATGG AAGTCGATCG CCAGCTTGCG ATCAGCATCC TATCATTAAT GTTATGATCT
ATACTAATTC TTCTGTAAAT AAATTAAAAT TGCACTAGTT TTTAACTAAA TGCTACTATT CTATTTTTTT ATCCATACTC
CGTTTGAGTG GTTTCTTTTG TGTTTCATGA AGCAATATAA TATGCTTAAG AAAACATAGA AACATGCACA ATACAATAAT
AGCGCTGGTA GAATCCGGTT GGAGACCAAA TGTTTCGATA TTCTAAGTGC ATATTTATAT ATACTAAGTA AAACTGTAAT
CATAAACATG CATATGGACT GTGATCGATG AAATGTTTCT TCATTTTTTT TTTCAAGATA ACTCTTCCCC AGTTGACAAC
ATGCACTGCA TCCAGAAGTA CTCATGGTAT TTGTTTTCAG TACTGTTTGA TGAGTAAAAC TTTGGTAAGT GTTAAAAAAT
GATGATAAGT GCAAATATTT GTTCCTTTAC CACTTCCACC TTCTTGGAGT AAAGAAAAAA ATGTGTGTGG TTTGGCAAAG
TTGTTGCATA TATCACGGCA TTAGTGTGCG GATAATGCGA ATAAATGCAT CAATAAGCAC TAGGAGTAAG TTAATTAGTT
CTCTACCTTA ATTGAAAAGT TCATGTACAT TTAAAAAAAT TAAACATGCC TCTTTTTATC ATTTGTTGAA TTTCTACATT
TATCAAGACA GCAAAGGAGT TCTCATCTAC TAATAAATTA ATTTAAGGAG CTATAACTCC CTTAATTTTA TCAAATATTC
ACATACACGG TTGCATTTGA GGATTTTCTA TATACTCCAC TAAATGAGGA TGCATTTAGG TTCTTTATAA TATTTTATTT
CCATCGTTTC ATCATCTGTT TATGTTTACA GTAATTTAGT AATAGTTCTC TAATTTTGAC AGTAATGGTT GGCTCACAGA
AAACATCAAC CAACCATATA TATTGGTTTA TACTGACAAA GAGTTTTTTT TTGTACAGGG AAATTGGTGC CATGAATACA
GGAAACTTAA GGCAAAGATT GAGACCATAC AAAAATGTCA CAAGTAATCG ATATATATAT CCAATTTCTA TAATAATGTT
AAATAAATTT CGAACTAATT GCACTAATTA TTATTTTTAA ACCAATTTAA AAGAGAACTT CCGGTATTGA CTGCTGAAGA
TGACGTGAAA CTAACTTATG TATCTTGTGT AGACACCTCA TGGGAGAGGA TCTAGAATCC CTGAATCTCA AAGAACTCCA
ACAGCTAGAG CAGCAGCTGG AGAGTTCATT GAAGCACATA ATATCAAGAA AGGTAGTATT TTTTTGGATA GTGGAATCTT
TTTATTTGAA CTCCCGACCT CTACACACCA AATGTACAGA AAAAAAGGAG CAAATTATTA AAAGAAACGT AGTAATATAT
TTAGCATGTT CTGTTTCAAA CTGGACTGAA TTGAAATAAT TCATGCATGC GCATGCCTGA GTTACATAAA TATATATCCA
AATGTCTTGT TGTCACTGCT ACTTTGAAAC AAATGTTCTT TTTTTTTTCC TTTTTGAGAA AATATATGAG TAAATATTTT
CAGCACATTC TGGAGGAACA ATTACCAAAT ATAAACTTTT TAGCACATTC TGGAGTACAA TTACCAAATA TGACGGACTA
ACTAGAACAA TATGTTTGTG TTTGCAGAGC CACCTTATGC TTGAGTCCAT TTCCGAGCTG CAGAAAAAGG TGACCAATTG
AACTGCACTA CTGTGTATGC ATGTATATAT GAATCGTGCA TGCAAACCGT TGTTAGCTAG TAGTTAGTTA TAGTTTACTC
TTGGTTAGTC TCAACTGATA GTGCAGTTTT CTTGCATGAG TGCAGGAGAG GTCACTGCAG GAGGAGAACA AGGCTCTGCA
GAAGGAAGTA AGTTGTCGAA AATATAGTAT TTACTGCTGC TTATATTAAT TAATTCATTC TGCTTGACTA GCCAATGGAG
GCACTAAACA TAATTAATTC ATGCGCATTG GTTTTGATCA ATTGATTTAT CTTGTTGACA ATTTTCCAAT CTATCCATGG
GTTTAATTAC TAGTTTTGTC AATGGAGGCA TTAGAGATAA TTAATTCATA TGCGCACTCG AAAGTTTGAA ATTGCTGTAG
TTTACTTGTT GGGTGGATCA TATCGCCAAT AATTTTTTCC CCCACAGTTG ACCGCAAATG AGAAGTAATT TTCTTTGCCT
TCTAGACTTG ACGGCTATTT TTTTAGCGTG TTGGCAATTG AACATATGAC CTTGGGTTAA AACCACACAT CTTTTATCAT
TGCGCTATCA AATACATCTC GATAAATTTG TCCCTTACTA GCGGTTTATG TGGTTTCCTT GGTGGTCGGT TTGTGCCTCT
TAGAAAAAAA TCGTGATGTT TGTAGTGTGC GCATGCAGCT GGTGGAGAGG CAGAAGAATG TGAGGGGCCA GCAGCAAGTA
GGGCAGTGGG ACCAAACCCA GGTCCAGGCC CAGGCCCAAG CCCAACCCCA AGCCCAGACA AGCTCCTCCT CCTCCTCCAT
GCTGAGGGAT CAGCAGGCAC TTCTTCCACC ACAAAATATC TGGTACGTAT ATGTCTGCAT TCATGTCTCA TCAGTTGCTA
TTCAGTTATA AATTAATCTG TTACTGCACT AATTAAGATC GATCACACCC TTGTTAAGTT CTAAGTCTCT AATTAATTAA
CTGCATGTAT ATAATTATGC ACATCTGTGC ATAGTAGCTA CCCGCCGGTG ATGATGGGCG AGAGAAATGA TGCGGCGGCG
GCGGCGGCGG TGGCGGCGCA GGGCCAGGTG CAACTCCGCA TCGGAGGTCT TCCGCCATGG ATGCTGAGCC ACCTCAATGC
TTAAGATGAT CATCGTCGTC GTCGTCGGCC AAACAGCTGC CGTATGCACC GTGAATCATG GGAGCAACCT TGAATGAATT
GAAGTCATTG GTATCGATCC TAGCGATAAT ATATATGATT CTCCTAAAAT GAAATTGATC TCAAAAAAAC AAACCTAGCG
ATTAAGCTAT TCTTATATAT GTGTTTGCCT GCTGCCCCCT ACCCTACAGG CTACATATGA TTTGCAAGAA ATTAATTATG
AGCAAGGATC AGGATGTGTC TTTGTGTAAT CATCAGCACG TACCTAGTGC TTCCTACTGA TATATATGCA TGCAATTGTG
TGCATATAAA TATATTTGCA TGCCATGCTC CCGTGATGGT TAATT

Locus: Os07g0108900

Loading...

Locus: Os07g0108900

Loading...