Os07t0124100-01

Locus

Os07g0124100

Description

Similar to Phytosulfokines 4 precursor.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PSK4

CGSNL Gene Name

PHYTOSULFOKINE 4

Oryzabase Gene Symbol Synonym(s)

OsPSK4, Psk4

Oryzabase Gene Name Synonym(s)

phytosulfokine 4

Transcript Evidence

AK063647 (DDBJ, Best hit)

Protein Evidence

Q9AR88 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cell proliferation (GO:0008283)

Cellular Component: extracellular region (GO:0005576)

Molecular Function: growth factor activity (GO:0008083)

Functional domain (InterPro)

Phytosulfokine (IPR009438)

Full-length cDNA

001-118-H12 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0124100-01)

RiceXPro (AK063647)

Others

Oryzabase (14420)

KEGG (Os07t0124100-01)

Transcript

588 bp

>Os07t0124100-01 Similar to Phytosulfokines 4 precursor.
acgccattactgctcctcaaacgagaccaaGAAATCAATCGTTCCAGCGAAGAAGAAGAA
GAAGAAGGAGGAATCCATGGCGGCGAGGACGGTGGCGGTGGCGGCGGCGCTCGCCGTGCT
GCTGATTTTCGCCGCCTCGTCGGCGACCGTGGCCATGGCCGGCCGGCCAACGCCTACGAC
GTCTCTCGACGAGGAAGCGGCTCAGGCGGCGGCGCAGTCGGAGATCGGCGGCGGGTGCAA
GGAAGGGGAAGGGGAGGAGGAGTGCCTCGCGAGGAGGACGCTGACGGCGCACACCGATTA
CATCTACACCCAGCAGCATCACAACTAATTAATCTTATCGATCAATCAATAATCAATCAA
TCAATCAGTCGCTTCCTCTTCGATCTACCAATACTAGTATTGGTATATAATTAAAACTGC
AAATCCGTCATGCATGCATGGTATGCCCATCGATCCATCCATGATTATCTCTAGTTAGAT
GTAGTAACAAACTGCATGCGCGTGTTGTGCTCATCAGTGTTAATTTTGGCCGCCCCCCTG
TTGATAAACAGTTCTTGATCGATGAGAGCTAGCTTTCGTTTTGTTTTG

CDS

252 bp

>Os07t0124100-01 Similar to Phytosulfokines 4 precursor.
ATGGCGGCGAGGACGGTGGCGGTGGCGGCGGCGCTCGCCGTGCTGCTGATTTTCGCCGCC
TCGTCGGCGACCGTGGCCATGGCCGGCCGGCCAACGCCTACGACGTCTCTCGACGAGGAA
GCGGCTCAGGCGGCGGCGCAGTCGGAGATCGGCGGCGGGTGCAAGGAAGGGGAAGGGGAG
GAGGAGTGCCTCGCGAGGAGGACGCTGACGGCGCACACCGATTACATCTACACCCAGCAG
CATCACAACTAA

Protein

84 aa

>Os07t0124100-01 Similar to Phytosulfokines 4 precursor.
MAARTVAVAAALAVLLIFAASSATVAMAGRPTPTTSLDEEAAQAAAQSEIGGGCKEGEGE
EECLARRTLTAHTDYIYTQQHHN*

5'UTR

chr07:1255669..1255744 (- strand) : 76 bp

CDS

chr07:1255552..1255668 (- strand) : 117 bp

chr07:1255307..1255441 (- strand) : 135 bp

3'UTR

chr07:1255047..1255306 (- strand) : 260 bp

FASTA

>Os07t0124100-01 class=Sequence position=chr07:1255047..1255744 (- strand)
acgccattac tgctcctcaa acgagaccaa GAAATCAATC GTTCCAGCGA AGAAGAAGAA GAAGAAGGAG GAATCCATGG
CGGCGAGGAC GGTGGCGGTG GCGGCGGCGC TCGCCGTGCT GCTGATTTTC GCCGCCTCGT CGGCGACCGT GGCCATGGCC
GGCCGGCCAA CGCCTACGAC GTCTCTCGAC GAGGTACGTA TATATACGCG ATCTCCTCGA CCTCATCTCG TCCTTCTCGT
TCATCATGGA TGGATGCATG TTCGATCTGA TCGATGATTG AGAATGAATG AATGAATCTG CAGGAAGCGG CTCAGGCGGC
GGCGCAGTCG GAGATCGGCG GCGGGTGCAA GGAAGGGGAA GGGGAGGAGG AGTGCCTCGC GAGGAGGACG CTGACGGCGC
ACACCGATTA CATCTACACC CAGCAGCATC ACAACTAATT AATCTTATCG ATCAATCAAT AATCAATCAA TCAATCAGTC
GCTTCCTCTT CGATCTACCA ATACTAGTAT TGGTATATAA TTAAAACTGC AAATCCGTCA TGCATGCATG GTATGCCCAT
CGATCCATCC ATGATTATCT CTAGTTAGAT GTAGTAACAA ACTGCATGCG CGTGTTGTGC TCATCAGTGT TAATTTTGGC
CGCCCCCCTG TTGATAAACA GTTCTTGATC GATGAGAGCT AGCTTTCGTT TTGTTTTG

Locus: Os07g0124100

Loading...

Locus: Os07g0124100

Loading...