Os07t0129700-01

Locus

Os07g0129700

Description

KNOTTED-type homeodomain protein, KNOX protein, Shoot formation during embryogenesis, Control of seed shattering, Control of internode development, Repression of lignin biosynthesis

RAP-DB Gene Symbol Synonym(s)

OSH15, Oskn3

RAP-DB Gene Name Synonym(s)

HOMEOBOX 15, Oryza sativa homeobox 15

CGSNL Gene Symbol

OSH15

CGSNL Gene Name

HOMEOBOX 15

Oryzabase Gene Symbol Synonym(s)

OSH15, OsH15, OSKN3, Oskn3, HOS3, D6, d6, OSH15/Oskn3, HB253, H15, OsKNOX3, KNOX3

Oryzabase Gene Name Synonym(s)

Oryza sativa homeobox15, Rice KNOX gene-15, Homeobox protein knotted-1-like 12, Homeobox protein OSH15, Homeobox protein HOS3, Homeobox protein knotted-1-like 3, KNOX PROTEIN 3, Oryza sativa Homeobox 15

Transcript Evidence

AK111877

AB016071

Protein Evidence

O80416

Literature

PMID: 28351912

PMID: 10080693

PMID: 9869405

Note

Manual Curation

May 16, 2017

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

KNOX1 (IPR005540)

KNOX2 (IPR005541)

ELK domain (IPR005539)

Homeobox domain-like (IPR009057)

Homeobox domain (IPR001356)

Homeobox KN domain (IPR008422)

Homeobox, conserved site (IPR017970)

Full-length cDNA

J033044D23 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0129700-01)

RiceXPro (AK111877)

Others

Oryzabase (2975)

KEGG (Os07t0129700-01)

Transcript

1465 bp

>Os07t0129700-01 KNOTTED-type homeodomain protein, KNOX protein, Shoot formation during embryogenesis, Control of seed shattering, Control of internode development, Repression of lignin biosynthesis
TCTCCCCTCCCTCTCGCCATTGGAGCTAGACAGCTCGAGCTCCAGGAGGAAGAAGAGAGA
GAGCCTAGCTGCTAGGGTTTCCATCGGATTTGGTTTTTTATTTTCTTTTTGTTTCTTGTG
TGTGTTTTGATGGATCAGAGCTTTGGGAATCTTggaggaggaggaggagcaggggggagc
ggcaaggcggcggcgtcgtcgttcctgcagctgccgctgtccacggcggcggcggccacc
gcgtactacggcacgccgctcgccttgcaccaggcggcggccgcggcTGgcccgtcgcag
taccacggtcacggtcacccccaccacggcggcggccaccaccacagcaagcacggcggc
gccggtggtggggagatctcggcggcggaggccgagtccatcaaggccaagatcatggcg
cacccccagtactccgccctcctcgcagcctacctcgactgccagaaagtcggagcgccg
ccggaggtgctggagaggctgaccgccacggcggcaaagctggacgcccgccctcccggc
cgccacgacgcgcgcgacccggagctcgaccagttcatggaggcgtactgcaacatgctg
gccaagtacagggaggagctgacgcggccgatcgacgaggccatggagttcctcaagagg
gtggagtcgcagctcgacACCATCGCCGGCGGCGCCCATGGCGGCGGCGCCGGCTCGGCG
CGCCTCCTCCTCGCCGATGGTAAATCTGAATGTGTTGGTTCTTCTGAGGATGACATGGAC
CCAAGTGGCCGCGAAAACGAGCCGCCTGAGATCGACCCGCGCGCTGAGGATAAGGAGCTC
AAGTTTCAGCTTCTGAAGAAGTACAGTGGCTACTTGAGCAGCCTAAGGCAAGAATTTTCC
AAGAAAAAGAAGAAAGGAAAGCTGCCTAAGGAGGCCAGGCAGAAGCTGCTTCACTGGTGG
GAGCTGCACTACAAGTGGCCTTACCCCTCAGAGACGGAGAAGATTGCGCTTGCGGAATCG
ACAGGACTAGATCAGAAGCAGATCAACAACTGGTTCATCAACCAGAGGAAACGGCACTGG
AAGCCATCGGAGGACATGCCGTTCGTCATGATGGAAGGTTTTCACCCACAGAATGCTGCT
GCATTGTACATGGATGGCCCGTTCATGGCAGATGGAATGTACCGCCTCGGTTCGTGAACC
TCGATCTCGATCATCGGCGTGTTTGATGAGAGATCCAATGCCAAGATAAATTGATCATGG
AATGTATTCAGCATGCGTTGCAATGCATGGACATTGTTATGGAATTTTTGGTTTATTTAC
CTTTCACCGTGGATTGACAAGGTCTCGATCATGTTAGTGTTGATGGCTTATAGTTCTCCA
GTAATGTTGTTGTTTTTCCTTTCGATGGCTTGTAAAAGTTTAGGTGTATCGGAATTTCGA
TCAACTTGCTCGTACGCTGGTAATT

CDS

1068 bp

>Os07t0129700-01 KNOTTED-type homeodomain protein, KNOX protein, Shoot formation during embryogenesis, Control of seed shattering, Control of internode development, Repression of lignin biosynthesis
ATGGATCAGAGCTTTGGGAATCTTggaggaggaggaggagcaggggggagcggcaaggcg
gcggcgtcgtcgttcctgcagctgccgctgtccacggcggcggcggccaccgcgtactac
ggcacgccgctcgccttgcaccaggcggcggccgcggcTGgcccgtcgcagtaccacggt
cacggtcacccccaccacggcggcggccaccaccacagcaagcacggcggcgccggtggt
ggggagatctcggcggcggaggccgagtccatcaaggccaagatcatggcgcacccccag
tactccgccctcctcgcagcctacctcgactgccagaaagtcggagcgccgccggaggtg
ctggagaggctgaccgccacggcggcaaagctggacgcccgccctcccggccgccacgac
gcgcgcgacccggagctcgaccagttcatggaggcgtactgcaacatgctggccaagtac
agggaggagctgacgcggccgatcgacgaggccatggagttcctcaagagggtggagtcg
cagctcgacACCATCGCCGGCGGCGCCCATGGCGGCGGCGCCGGCTCGGCGCGCCTCCTC
CTCGCCGATGGTAAATCTGAATGTGTTGGTTCTTCTGAGGATGACATGGACCCAAGTGGC
CGCGAAAACGAGCCGCCTGAGATCGACCCGCGCGCTGAGGATAAGGAGCTCAAGTTTCAG
CTTCTGAAGAAGTACAGTGGCTACTTGAGCAGCCTAAGGCAAGAATTTTCCAAGAAAAAG
AAGAAAGGAAAGCTGCCTAAGGAGGCCAGGCAGAAGCTGCTTCACTGGTGGGAGCTGCAC
TACAAGTGGCCTTACCCCTCAGAGACGGAGAAGATTGCGCTTGCGGAATCGACAGGACTA
GATCAGAAGCAGATCAACAACTGGTTCATCAACCAGAGGAAACGGCACTGGAAGCCATCG
GAGGACATGCCGTTCGTCATGATGGAAGGTTTTCACCCACAGAATGCTGCTGCATTGTAC
ATGGATGGCCCGTTCATGGCAGATGGAATGTACCGCCTCGGTTCGTGA

Protein

356 aa

>Os07t0129700-01 KNOTTED-type homeodomain protein, KNOX protein, Shoot formation during embryogenesis, Control of seed shattering, Control of internode development, Repression of lignin biosynthesis
MDQSFGNLGGGGGAGGSGKAAASSFLQLPLSTAAAATAYYGTPLALHQAAAAAGPSQYHG
HGHPHHGGGHHHSKHGGAGGGEISAAEAESIKAKIMAHPQYSALLAAYLDCQKVGAPPEV
LERLTATAAKLDARPPGRHDARDPELDQFMEAYCNMLAKYREELTRPIDEAMEFLKRVES
QLDTIAGGAHGGGAGSARLLLADGKSECVGSSEDDMDPSGRENEPPEIDPRAEDKELKFQ
LLKKYSGYLSSLRQEFSKKKKKGKLPKEARQKLLHWWELHYKWPYPSETEKIALAESTGL
DQKQINNWFINQRKRHWKPSEDMPFVMMEGFHPQNAAALYMDGPFMADGMYRLGS*

5'UTR

chr07:1566125..1566253 (+ strand) : 129 bp

CDS

chr07:1566254..1566592 (+ strand) : 339 bp

chr07:1566702..1566812 (+ strand) : 111 bp

chr07:1566962..1567118 (+ strand) : 157 bp

chr07:1571215..1571468 (+ strand) : 254 bp

chr07:1571611..1571817 (+ strand) : 207 bp

3'UTR

chr07:1571818..1572085 (+ strand) : 268 bp

FASTA

>Os07t0129700-01 class=Sequence position=chr07:1566125..1572085 (+ strand)
TCTCCCCTCC CTCTCGCCAT TGGAGCTAGA CAGCTCGAGC TCCAGGAGGA AGAAGAGAGA GAGCCTAGCT GCTAGGGTTT
CCATCGGATT TGGTTTTTTA TTTTCTTTTT GTTTCTTGTG TGTGTTTTGA TGGATCAGAG CTTTGGGAAT CTTggaggag
gaggaggagc aggggggagc ggcaaggcgg cggcgtcgtc gttcctgcag ctgccgctgt ccacggcggc ggcggccacc
gcgtactacg gcacgccgct cgccttgcac caggcggcgg ccgcggcTGg cccgtcgcag taccacggtc acggtcaccc
ccaccacggc ggcggccacc accacagcaa gcacggcggc gccggtggtg gggagatctc ggcggcggag gccgagtcca
tcaaggccaa gatcatggcg cacccccagt actccgccct cctcgcagcc tacctcgact gccagaaagt ATATACGCTC
GATTAATTCT TCTCCGATTT TGTTGAACAA AATACTCCGT AGTAATTATC TATCGATCAT ATATATCACT GCAATTTTGA
TCCATCCATC catccaggtc ggagcgccgc cggaggtgct ggagaggctg accgccacgg cggcaaagct ggacgcccgc
cctcccggcc gccacgacgc gcgcgacccg gagctcgacc agttcatggT TCGTTCGTCC CCCCCCAACT CCGGCGACCA
GTTCATATAT CGTTCATGAT ATATTGACCC GTCCGTACGA CGTTGAATCG ATCAATCACC GATGTTGGTT GCATTGATCG
GGTTGATTAA TCGGAATCGA ATCAATCTTC GACGCAggag gcgtactgca acatgctggc caagtacagg gaggagctga
cgcggccgat cgacgaggcc atggagttcc tcaagagggt ggagtcgcag ctcgacACCA TCGCCGGCGG CGCCCATGGC
GGCGGCGCCG GCTCGGCGCG CCTCCTCCTC GCCGGTAAAT CAACCAATCA TCCATCCCCC TCCTCCTGCT CTCGCCTGCG
GTTTTACTTC TATTTACACA CATGCTCCTT CTGCTTCTTC TCTTCTGCTG CTGCTGCTGC TGCTGATGAT GATGATCTCG
TCGTCGGCGG CGATGGCGGC GGCGGCGGCG GCGGAGGCTT ACCGCATTAG GAAATAGTTT GATCCGGATA ATGGAGGTGG
TTGCTTTGGA TGATTGCCAT TGTTAGTATA GCTACCCATC CAAAGCCCTG TGGATTAGTA ATTTATTTAT TGGGGTTAGT
AACAAGACGC CTTTGCAGCA GCATGCACTA ACAAAAGTAA TTAAACTAAC AATTAGTAGC GGTCTAGTCG AGTGATTAAT
CTAATCATGT TGGCAACCAG GGCACTGTGA GCAACCATGT CTCAAGCTTC TCCTCCTCTC GTTTCAGCAG CTTCACCTCC
ATTGTTTATT GCATCCATCC ATCCATCCAT GGCAGCAGCT AGCACAGCCT AGTTGCAAAA CACAACACAT GCTAGCCTTT
CAACTCAACC ATTTCTTTTT TCCCCTCTTT CTTTTGGCCA TGAATTGTCT CTTCTCTCTT TCTTTTCTTA CTGCTCTACT
AGATGACAAG TGACTAGAAG CCTTGTCTTT AGGGTTCCAA GGCATGCAGG GCAGAGGAGA GAATCAGCCT GTCTATAGAC
TAATAGCTAG ATTGATGGAG ATTCTGAATG GTGATTAAGC CCAGTAAACA ATGGTTTGAG GAAGAGTATT ATAACTACAT
AGAGATGTAT GGCAGTACAA GCTTGGTTAA TCATCTCTCT GGTTGCTGCT GATTGGATAG CATGCATGCA TCTACCCCGG
ATCAGTAGTA TTATTCTTTT CTTGCTCTAG TGGAAGTAGA GCCATATGCA TTGGAAATTG TTGTCATGGG GCTAGCTAGG
TACCCAATGT TGCAGCAGCA CTGTACGAAC CGTCTTTCTT CTTCGCACGT AGCACTGCAG CTGTTCTTGT AATGGTTTTG
GGATGCAGCA CAGATTCATC TGGGCGTTCG TGTTTTCCGG GGGGTTGTAC TGTCGATTGC TGCAGGGCAG GATAATCAAT
TAATATGATA GAGATCTGAT GAACTGTTGA TAGACTACTG TTGAATGCTT TTTATTTTCT GTGCATATAT ATATGTATAG
AAGTATTGGA GAAGAGTGTC TGATTGGTAG ATCAAACTAG GTCAGTTGCA TTTGATTCAT GATGGAAATT AAGACAGTTG
TTGGAGCTTG CCAGCTGCTA CTAGTAGTTT TCCTTTTTTT TTCTTGTGAA AGATTCAATT TGATTAAGCA GAGATGCAAC
TTTATTAGGC AATATTAGTG GAAGTCCCTT AAATGAAAAG TTACAGAACC ATATATTATC AAAGGTTTTT ATGAACAATA
TACAAATTTA TTCTATGATC ATTTTTTATA TTACTAAATC TATGTTCGTC AGATATTGGG AAAGATTCAC CCGGCACTTA
TGCTGCAAAT GTGAACTCTT CTCTATTATC TAAAACAAAT GGGAGAGATT ACTAGTTTCT TATCTCTGTG ATGCTCAAAA
CCTCACATGG TGATTCTGTA TTCTCTCTAT ATAAGCCTAG CGCATCTATG CTGAATTTTC ACAAATAAAT CTCAACTATT
GAAATTAGGC CACTTCAAAA GATCTTTTGT CAATGAGTTT GCTATATGTT GGTTTACTTC TATGATTGCT TTTTTGATAA
TGTATTTCAT CTCATCCTCG CGCATGCATG CCCGGTTATT TATTGCCAGT TATGTGTTCC ATTTGAGATT TAAAGAACCA
GCTAATATAT TATTATTGTT TTTCTTGTTT GTTATGGTAT GACAACTGTC CTAGCAAATC CACATCCACA CATCGATCTA
TATATCTTAA CCAATCAGCA AGGCTCTATT TGTTTGTATA GATCAGCATG TTGTTTATAT CGCATCATTG GTATTAAATT
GTAACAGTTG CCTACTATAC TGGTGAAACT TCTGCCTTTA AAACAAATGA CACTAGCTTA TACATTAAAC AAATATGATT
GTGCAAATGC ATTTACTAAT TTTTTTTATC TAATAAACTG TGCTTGTCAC TTGTCAGTGT TTAACAAACT GTCCATTTTT
CAGTCATTCA TAAGTGTCAG TTTCCGCACC ATTAGTTTTA GTATTATGGT TTCCTACTCT TGCCATGTAT GCTTAATTAG
ATTCACTTTG CTGAAACTTG GAAAATTACC ATTAATGTGT CCAAATCCAT GGACTGGTTT TGATTTTATA ATTTTATCAA
AACTGTTTGA GAAATGTATT TTTCAAATGA ATTATCATGT TTACTCATTC CACAAGTTAA TTAACGTGTT TCTCCTCAAA
ATAAGCTAAT GCGTTTTCTA TAGGCGCCAC AAATAAAAAG CAAAGGGTTC ATTCACAAAA TTTTGAAGGT TTTTTTTAGC
AAATACCAAG TGCCATGTTA TTAAAAGATT AAAATCTTGT CACTGTTAAT GCATTAGTAC ATCAGGAATA ATTCTTTTTC
TGCGTAGAAG CACAAGGGCA ACATTGGTGT ATTTGTCATG CCATTTCCTT TTTTCATGTT ATTTGTACCT CATCTTAAAA
AAAAGGAGAA AGTATTACAT AGGGGACTAA TAGCTTATGT GAAAGACCAC CGACTGGTTT ATAATTAAAC ACTGGCTCAT
TTCTTTGAAG CTTTTTTTTT AAGGATCTGG TTTTCCCTCT AGTAGTTCTG AGCTGATGAA AAGTTTCTAT AGCGGGTTAC
TGAGAGAATT ACAGTCATTG TGCTACCATG AGAATAAATA CAATAACAGA GTAACAACCA TGAGAATATG TTCAAGAACT
AATGGATTCT AAAATTTGAA AGGCGCTTAA AATGTTTTCT TGACACTATT CATGATGAGA ATTAAACGGT TAATCAAGTA
AGACATGGGA CGATAACAAC TACTACCTAA TCCTGTAAAT CTACAGAATC TCCATGCTTT TCAGTTGCTT TTTATGCACC
CACAATATAG TTTTCAGTTG CATGTTATCA TTGGAGGATG TAGAATACTC ATGCATGCAC AATTTTTTAT AATATGGGGC
CACATATATT ATCTTTTATT TTCTTGTATC ACATCCTGGG TCAGATCAAC AACTGTCACT GTACAGTTTC CTATGTATAG
ATCAATTATT TTGATTGCCC ATCTGAAATT AAGTTATGGT CATATGTATC TTTATTTATT TTGAAGTTGA TCTCCGAATT
ATTCAATTAC ATAGGCCCAA GACAACGCTT TATGTGTGAT ATTTTTGTTT CTGGTTGTAT GGTAGTAATT TTTGTTTTTT
TGCTTTTATT TTATCCATTT CTTTGTTATA TGCTATATTC TGTAGGACGC ATGGTCAGCA TGTGACCATT CTGTTTAGAG
CAGAGAAATG CTCTGTCAAT TCTTTATTTC TTTCCACTAA ATGATTCTTT ATCTACTGCC ATAATATGTA TTCCTTTGAC
CATTGGACCA AGTTTTTTAG GCCAAAGACC TAGCTTTTAT ATAAAGCAAA AGAACATAGG TGATAAGAGA TAGGACCAAG
TTTCAGTCAG TATCATTTTT TTCGTCGAAG CCTGGGACTC TACGTATACC TAGTTCAGTG GTTTCTACTA TTTGGTTTAT
CAAACACTGT TTTAAAACCA TAATCTGCAC ACCACAATCT GGTCAATATA TCTTTCAACT GGCTGATTTG GCACAAATCA
AACCTGACAA ATTAATAAAC CTAAAGCAGT GCTAGTTTTA TCCTTGTATT GAATATCCTT GTCTTTTCAC TTGCATAGTT
TTTTTTACCG TTTTTTATAG TGTTTTCTTC TACGAAATCA GTAGGGCAGG ATCCTTCTTG AAATCCATAC TCTTTACTGT
AGCTACTCTA CCAGTAGTCA AATACACAGT GTCACCCTAT TCTTGCATTC CAAAATGGAT AGAGTTGTTT ACCCACAGCT
ATGGGCCTTT CTGCGTCTGT TCCATTGCTG ACCAACATGG TCTAGACTGA AGCTCATTCC AACAATACAA TAGAAATCTG
ATGAACAAAA TGTAGTATGA TCTCTTACAT TAACCACCTT TTGTCTGCAG ATGGTAAATC TGAATGTGTT GGTTCTTCTG
AGGATGACAT GGACCCAAGT GGCCGCGAAA ACGAGCCGCC TGAGATCGAC CCGCGCGCTG AGGATAAGGA GCTCAAGTTT
CAGCTTCTGA AGAAGTACAG TGGCTACTTG AGCAGCCTAA GGCAAGAATT TTCCAAGAAA AAGAAGAAAG GAAAGCTGCC
TAAGGAGGCC AGGCAGAAGC TGCTTCACTG GTGGGAGCTG CACTACAAGT GGCCTTACCC CTCAGTAAGA TTACACATAC
AAAATTACCT GATAATATAT AGTAATTGCC ACAATTACCT AATGCATACA TAGTTCTACA AACATCTTAG TTCAGATCAG
ATGCATCATC ACATTGTTAC TAACTTTGCA CCAATGGGAT GAGTAGGAGA CGGAGAAGAT TGCGCTTGCG GAATCGACAG
GACTAGATCA GAAGCAGATC AACAACTGGT TCATCAACCA GAGGAAACGG CACTGGAAGC CATCGGAGGA CATGCCGTTC
GTCATGATGG AAGGTTTTCA CCCACAGAAT GCTGCTGCAT TGTACATGGA TGGCCCGTTC ATGGCAGATG GAATGTACCG
CCTCGGTTCG TGAACCTCGA TCTCGATCAT CGGCGTGTTT GATGAGAGAT CCAATGCCAA GATAAATTGA TCATGGAATG
TATTCAGCAT GCGTTGCAAT GCATGGACAT TGTTATGGAA TTTTTGGTTT ATTTACCTTT CACCGTGGAT TGACAAGGTC
TCGATCATGT TAGTGTTGAT GGCTTATAGT TCTCCAGTAA TGTTGTTGTT TTTCCTTTCG ATGGCTTGTA AAAGTTTAGG
TGTATCGGAA TTTCGATCAA CTTGCTCGTA CGCTGGTAAT T