Os07t0139300-01

Locus

Os07g0139300

Description

ALOG domain-containing nuclear protein, Transcriptional regulation, Specification of sterile lemma identity

RAP-DB Gene Symbol Synonym(s)

G1, g1 (lng), lng, g1, ELE

RAP-DB Gene Name Synonym(s)

LONG STERILE LEMMAS 1, long sterile lemmas1, long sterile lemmas 1, long sterile lemmas-1, elongated empty glume, long sterile lemma/glume1

CGSNL Gene Symbol

G1

CGSNL Gene Name

LONG STERILE LEMMAS 1

Oryzabase Gene Symbol Synonym(s)

g1 (lng), lng, g1, ELE, OsG1, G1/ELE, LSL2, OsLSL2

Oryzabase Gene Name Synonym(s)

long sterile lemmas1, long sterile lemmas 1, long sterile lemmas-1, elongated empty glume, long sterile lemma/glume1, long sterile lemma 2

Transcript Evidence

AB512480

FJ502130

Protein Evidence

Q8GVZ6

Literature

PMID: 19901325

PMID: 20227044

Note

Manual Curation

July 8, 2015

Functional domain (InterPro)

ALOG domain (IPR006936)

Expression Databases

TENOR (Os07t0139300-00)

Others

Oryzabase (811)

Transcript

991 bp

>Os07t0139300-01 ALOG domain-containing nuclear protein, Transcriptional regulation, Specification of sterile lemma identity
AGACGCATTCTGTCACGTCTCTCTAGTGTTACTGCGTAACGTAGGTGGCCGCTGCCGGCC
ATGTCGTCGTCGTCCGCTGCCGCGCTGGGCTCCGACGACGGCTGCTCGCCGGCGGAGCTG
CGGCCGAGCCGGTACGAGTCGCAGAAGCGCCGGGACTGGCAGACCTTCACGCAGTACCTC
GCCGCGCACCGCCCGCCGCTCGAGCTCCGCCGCTGCAGCGGCGCCCACGTCCTCGAGTTC
CTCCGCTACCTCGACCGCTTCGGCAAGACGCGCGTCCACGAGCCGCCGTGCCCGTCGTAC
GGCGGCCGCTCGCCGTCCGCCGCCGGCCCGGTCGCCGCCGCCGCCGCCGCATGCCAGTGC
CCGCTGCGCCAGGCGTGGGGCAGCCTCGACGCGCTCGTCGGCCGCCTCCGCGCCGCCTAC
GACGAGCGTCACGGCCGCGCCGGGGAGCCCGACGCCGTCGCGGGCGCCGGCGCGGTCGCC
ACCGACAGTACCTCCTCCTCCTCCGCCGCCGCCGCCAACCCCTTCGCCGCGCGCGCCGTG
AGGCTGTACCTGCGCGACGTCCGCGACGCGCAGGCCATGGCGCGCGGCATCTCCTATCAC
AAGAAGAAGAAGCGCAGGGGCGGCAACATGAACGGCGCCCGCGGCGGCGGCGGCGGCGGC
GCGCGCGCGGGCGTGAACGACGGCGATGCGACGGCGCCGCCGGTGGCGGTGACCCCGGGG
CTACCTCTGCCGCCGCTGCCACCGTGCCTCAACGGTGTGCCGTTCGAGTACTGCGACTTC
GGGAGCGTCCTCGGGGGAGCACATGGCGCCCATGGCGGCCATGGCGGCGGCGGCGGCGGC
TTCTACGGCGCCGGCGTCTACTTGCCATTTCTGTACAACACCTTCAGTTAGTTAGCTAGC
TAGCTAGTTCGTCGTGTATTTGTCTGTGCTTCTCACTGTGGTTGCTTCAGTGTACTAGCT
AGCTACATGTGTGATGTGTCTGCATCTTGTG

CDS

831 bp

>Os07t0139300-01 ALOG domain-containing nuclear protein, Transcriptional regulation, Specification of sterile lemma identity
ATGTCGTCGTCGTCCGCTGCCGCGCTGGGCTCCGACGACGGCTGCTCGCCGGCGGAGCTG
CGGCCGAGCCGGTACGAGTCGCAGAAGCGCCGGGACTGGCAGACCTTCACGCAGTACCTC
GCCGCGCACCGCCCGCCGCTCGAGCTCCGCCGCTGCAGCGGCGCCCACGTCCTCGAGTTC
CTCCGCTACCTCGACCGCTTCGGCAAGACGCGCGTCCACGAGCCGCCGTGCCCGTCGTAC
GGCGGCCGCTCGCCGTCCGCCGCCGGCCCGGTCGCCGCCGCCGCCGCCGCATGCCAGTGC
CCGCTGCGCCAGGCGTGGGGCAGCCTCGACGCGCTCGTCGGCCGCCTCCGCGCCGCCTAC
GACGAGCGTCACGGCCGCGCCGGGGAGCCCGACGCCGTCGCGGGCGCCGGCGCGGTCGCC
ACCGACAGTACCTCCTCCTCCTCCGCCGCCGCCGCCAACCCCTTCGCCGCGCGCGCCGTG
AGGCTGTACCTGCGCGACGTCCGCGACGCGCAGGCCATGGCGCGCGGCATCTCCTATCAC
AAGAAGAAGAAGCGCAGGGGCGGCAACATGAACGGCGCCCGCGGCGGCGGCGGCGGCGGC
GCGCGCGCGGGCGTGAACGACGGCGATGCGACGGCGCCGCCGGTGGCGGTGACCCCGGGG
CTACCTCTGCCGCCGCTGCCACCGTGCCTCAACGGTGTGCCGTTCGAGTACTGCGACTTC
GGGAGCGTCCTCGGGGGAGCACATGGCGCCCATGGCGGCCATGGCGGCGGCGGCGGCGGC
TTCTACGGCGCCGGCGTCTACTTGCCATTTCTGTACAACACCTTCAGTTAG

Protein

276 aa

>Os07t0139300-01 ALOG domain-containing nuclear protein, Transcriptional regulation, Specification of sterile lemma identity
MSSSSAAALGSDDGCSPAELRPSRYESQKRRDWQTFTQYLAAHRPPLELRRCSGAHVLEF
LRYLDRFGKTRVHEPPCPSYGGRSPSAAGPVAAAAAACQCPLRQAWGSLDALVGRLRAAY
DERHGRAGEPDAVAGAGAVATDSTSSSSAAAANPFAARAVRLYLRDVRDAQAMARGISYH
KKKKRRGGNMNGARGGGGGGARAGVNDGDATAPPVAVTPGLPLPPLPPCLNGVPFEYCDF
GSVLGGAHGAHGGHGGGGGGFYGAGVYLPFLYNTFS*

5'UTR

chr07:2068175..2068234 (- strand) : 60 bp

CDS

chr07:2067344..2068174 (- strand) : 831 bp

3'UTR

chr07:2067244..2067343 (- strand) : 100 bp

FASTA

>Os07t0139300-01 class=Sequence position=chr07:2067244..2068234 (- strand)
AGACGCATTC TGTCACGTCT CTCTAGTGTT ACTGCGTAAC GTAGGTGGCC GCTGCCGGCC ATGTCGTCGT CGTCCGCTGC
CGCGCTGGGC TCCGACGACG GCTGCTCGCC GGCGGAGCTG CGGCCGAGCC GGTACGAGTC GCAGAAGCGC CGGGACTGGC
AGACCTTCAC GCAGTACCTC GCCGCGCACC GCCCGCCGCT CGAGCTCCGC CGCTGCAGCG GCGCCCACGT CCTCGAGTTC
CTCCGCTACC TCGACCGCTT CGGCAAGACG CGCGTCCACG AGCCGCCGTG CCCGTCGTAC GGCGGCCGCT CGCCGTCCGC
CGCCGGCCCG GTCGCCGCCG CCGCCGCCGC ATGCCAGTGC CCGCTGCGCC AGGCGTGGGG CAGCCTCGAC GCGCTCGTCG
GCCGCCTCCG CGCCGCCTAC GACGAGCGTC ACGGCCGCGC CGGGGAGCCC GACGCCGTCG CGGGCGCCGG CGCGGTCGCC
ACCGACAGTA CCTCCTCCTC CTCCGCCGCC GCCGCCAACC CCTTCGCCGC GCGCGCCGTG AGGCTGTACC TGCGCGACGT
CCGCGACGCG CAGGCCATGG CGCGCGGCAT CTCCTATCAC AAGAAGAAGA AGCGCAGGGG CGGCAACATG AACGGCGCCC
GCGGCGGCGG CGGCGGCGGC GCGCGCGCGG GCGTGAACGA CGGCGATGCG ACGGCGCCGC CGGTGGCGGT GACCCCGGGG
CTACCTCTGC CGCCGCTGCC ACCGTGCCTC AACGGTGTGC CGTTCGAGTA CTGCGACTTC GGGAGCGTCC TCGGGGGAGC
ACATGGCGCC CATGGCGGCC ATGGCGGCGG CGGCGGCGGC TTCTACGGCG CCGGCGTCTA CTTGCCATTT CTGTACAACA
CCTTCAGTTA GTTAGCTAGC TAGCTAGTTC GTCGTGTATT TGTCTGTGCT TCTCACTGTG GTTGCTTCAG TGTACTAGCT
AGCTACATGT GTGATGTGTC TGCATCTTGT G

Locus: Os07g0139300

Loading...

Locus: Os07g0139300

Loading...