Os07t0141400-01

Locus

Os07g0141400

Description

Similar to 23 kDa polypeptide of photosystem II.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PSBP

CGSNL Gene Name

PHOTOSYSTEM II SUBUNIT

Oryzabase Gene Symbol Synonym(s)

PsbP, OsPsbP, psbP

Oryzabase Gene Name Synonym(s)

PSII subunit PsbP, photosystem II subunit PsbP, Chloroplast 23 KD polypeptide of photosystem II, Oxygen-evolving enhancer protein 2

Transcript Evidence

AK065248 (DDBJ, Best hit)

Protein Evidence

O65103 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: photosynthesis (GO:0015979)

Cellular Component: photosystem II (GO:0009523)

Cellular Component: oxygen evolving complex (GO:0009654)

Cellular Component: extrinsic to membrane (GO:0019898)

Molecular Function: calcium ion binding (GO:0005509)

Functional domain (InterPro)

Photosystem II PsbP, oxygen evolving complex (IPR002683)

Twin-arginine translocation pathway, signal sequence (IPR006311)

Mog1/PsbP, alpha/beta/alpha sandwich (IPR016123)

Mog1/PsbP/DUF1795, alpha/beta/alpha sandwich (IPR016124)

Full-length cDNA

J013002J02 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0141400-01)

RiceXPro (AK065248)

Others

Oryzabase (9595)

KEGG (Os07t0141400-01)

Transcript

1109 bp

>Os07t0141400-01 Similar to 23 kDa polypeptide of photosystem II.
TATCCCGTCGCCACCTCGCCCCATCACCCTCTCCCTCCACCACACTACACCCCGCTCCAC
TCTCAGGCAGGCAATCAGCGGCGAGGCACCAGCCCACCGGCCGGCAATGGCGTCCACCTC
CTGCTTCCTCCACCAGTCCACGGCCCGCGTCGCCGCGCGCGTCGCCTCCCCGTCCCCGGC
GACACGGACCCACCTCCTCGTCTGCCGCGCCCAGAAGCAGGACGACGCCGACGTCTCCCG
CCGCGCGGCGCTCGCGCTGCTGGCCGGAGCGACGGCGGCGGTGGGGGTGAAGGTGGCGCC
CGCCGCCGCGGCCTACGGCGAGGCGGCGAACGTGTTCGGGAAGCCCAAGACGAACACGGA
GTTCATCGCCTACAGCGGCGAGGGGTTCAAGCTGCTGATCCCGTCCAAGTGGAACCCCAG
CAAGGAGCGCGAGTTCCCCGGACAGGTCCTCCGCTACGAGGACAACTTCGACGCCAACAG
CAACGTCTCCGTCATAATCAACCCCACCACCAAGAAGACCATCACCGAGTTCGGCTCCCC
CGAGGAGTTCCTCGCCCAGGTCGACTTCTTGCTTGGCAAGCAGGCCTACTCCGGCAAGAC
AGATTCCGAGGGTGGGTTTGAGTCGGACGCGGTGGCGACGGCGAACATCCTGGAGAGCTC
GGCGCCGGTGGTGGGAGGGAAGCAGTACTACAGCGTAACGGTGCTGACGAGGACGGCGGA
CGGCGACGAGGGCGGCAAGCACCAGCTGATCACGGCCACCGTCAACGACGGCAAGCTGTA
CATCTGCAAGGCGCAGGCCGGCGACAAGAGGTGGTTCAAGGGCGCCAGGAAGTTCGTCGA
GAGCGCAGCCAGCTCCTTCAGCGTCGCATGATCGTCGAAATCTCTATCTCAGCTTCTCTT
TAATCCCTAGCGAATCAAAATCAAATCAATCGAGTTCGTTGCTCAGAGAGATGCAGTGCA
CGCATGTGTGTGTGCGTGTGTGTTTCTTTGATTGTACATGAGAATTAAGAACAAGTTAAG
GAGAGAGGTCGATCCATCGATTTCCCCTGCATGCAAGGATTGATTTTCTGTGATCCGTGT
GTTAAGTAATCCTAGTAATTAATCATGTT

CDS

765 bp

>Os07t0141400-01 Similar to 23 kDa polypeptide of photosystem II.
ATGGCGTCCACCTCCTGCTTCCTCCACCAGTCCACGGCCCGCGTCGCCGCGCGCGTCGCC
TCCCCGTCCCCGGCGACACGGACCCACCTCCTCGTCTGCCGCGCCCAGAAGCAGGACGAC
GCCGACGTCTCCCGCCGCGCGGCGCTCGCGCTGCTGGCCGGAGCGACGGCGGCGGTGGGG
GTGAAGGTGGCGCCCGCCGCCGCGGCCTACGGCGAGGCGGCGAACGTGTTCGGGAAGCCC
AAGACGAACACGGAGTTCATCGCCTACAGCGGCGAGGGGTTCAAGCTGCTGATCCCGTCC
AAGTGGAACCCCAGCAAGGAGCGCGAGTTCCCCGGACAGGTCCTCCGCTACGAGGACAAC
TTCGACGCCAACAGCAACGTCTCCGTCATAATCAACCCCACCACCAAGAAGACCATCACC
GAGTTCGGCTCCCCCGAGGAGTTCCTCGCCCAGGTCGACTTCTTGCTTGGCAAGCAGGCC
TACTCCGGCAAGACAGATTCCGAGGGTGGGTTTGAGTCGGACGCGGTGGCGACGGCGAAC
ATCCTGGAGAGCTCGGCGCCGGTGGTGGGAGGGAAGCAGTACTACAGCGTAACGGTGCTG
ACGAGGACGGCGGACGGCGACGAGGGCGGCAAGCACCAGCTGATCACGGCCACCGTCAAC
GACGGCAAGCTGTACATCTGCAAGGCGCAGGCCGGCGACAAGAGGTGGTTCAAGGGCGCC
AGGAAGTTCGTCGAGAGCGCAGCCAGCTCCTTCAGCGTCGCATGA

Protein

255 aa

>Os07t0141400-01 Similar to 23 kDa polypeptide of photosystem II.
MASTSCFLHQSTARVAARVASPSPATRTHLLVCRAQKQDDADVSRRAALALLAGATAAVG
VKVAPAAAAYGEAANVFGKPKTNTEFIAYSGEGFKLLIPSKWNPSKEREFPGQVLRYEDN
FDANSNVSVIINPTTKKTITEFGSPEEFLAQVDFLLGKQAYSGKTDSEGGFESDAVATAN
ILESSAPVVGGKQYYSVTVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGA
RKFVESAASSFSVA*

5'UTR

chr07:2138230..2138335 (- strand) : 106 bp

CDS

chr07:2137777..2138229 (- strand) : 453 bp

chr07:2137626..2137676 (- strand) : 51 bp

chr07:2137119..2137379 (- strand) : 261 bp

3'UTR

chr07:2136881..2137118 (- strand) : 238 bp

FASTA

>Os07t0141400-01 class=Sequence position=chr07:2136881..2138335 (- strand)
TATCCCGTCG CCACCTCGCC CCATCACCCT CTCCCTCCAC CACACTACAC CCCGCTCCAC TCTCAGGCAG GCAATCAGCG
GCGAGGCACC AGCCCACCGG CCGGCAATGG CGTCCACCTC CTGCTTCCTC CACCAGTCCA CGGCCCGCGT CGCCGCGCGC
GTCGCCTCCC CGTCCCCGGC GACACGGACC CACCTCCTCG TCTGCCGCGC CCAGAAGCAG GACGACGCCG ACGTCTCCCG
CCGCGCGGCG CTCGCGCTGC TGGCCGGAGC GACGGCGGCG GTGGGGGTGA AGGTGGCGCC CGCCGCCGCG GCCTACGGCG
AGGCGGCGAA CGTGTTCGGG AAGCCCAAGA CGAACACGGA GTTCATCGCC TACAGCGGCG AGGGGTTCAA GCTGCTGATC
CCGTCCAAGT GGAACCCCAG CAAGGAGCGC GAGTTCCCCG GACAGGTCCT CCGCTACGAG GACAACTTCG ACGCCAACAG
CAACGTCTCC GTCATAATCA ACCCCACCAC CAAGAAGACC ATCACCGAGT TCGGCTCCCC CGAGGAGTTC CTCGCCCAGG
TAAATAAAAA AAAATATTTT ATCGTTTTAG ACATTGACAC GGTCTCTCTA TAAGATAAAG TAGAAATAGT TCTGAATTAA
CGATTGCTTT CTTGTTCAGG TCGACTTCTT GCTTGGCAAG CAGGCCTACT CCGGCAAGAC AGATTCCGAG GTAACGTATT
TGATGTTCGA GACAGGATTT GGTCAAACTT TTCGAAACTT TACATACATG AGAATGCTAT AGTACGCTAT CATGTTCAGA
CAGGATGATA TCTCGTAGTT ATCGGCTGAT ACGGTATCAT CCCGTCCGAA CAAGGTATCA GACATCTTGT TCGAACGGGA
TATCGTCTTG TAGTATTTCC CTTTAAATAT GATGTTTTTG CGAGAATGTG TTGTGATGTG TGGATATGCG ATATAGGGTG
GGTTTGAGTC GGACGCGGTG GCGACGGCGA ACATCCTGGA GAGCTCGGCG CCGGTGGTGG GAGGGAAGCA GTACTACAGC
GTAACGGTGC TGACGAGGAC GGCGGACGGC GACGAGGGCG GCAAGCACCA GCTGATCACG GCCACCGTCA ACGACGGCAA
GCTGTACATC TGCAAGGCGC AGGCCGGCGA CAAGAGGTGG TTCAAGGGCG CCAGGAAGTT CGTCGAGAGC GCAGCCAGCT
CCTTCAGCGT CGCATGATCG TCGAAATCTC TATCTCAGCT TCTCTTTAAT CCCTAGCGAA TCAAAATCAA ATCAATCGAG
TTCGTTGCTC AGAGAGATGC AGTGCACGCA TGTGTGTGTG CGTGTGTGTT TCTTTGATTG TACATGAGAA TTAAGAACAA
GTTAAGGAGA GAGGTCGATC CATCGATTTC CCCTGCATGC AAGGATTGAT TTTCTGTGAT CCGTGTGTTA AGTAATCCTA
GTAATTAATC ATGTT