Os07t0141400-02

Locus

Os07g0141400

Description

Similar to 23 kDa polypeptide of photosystem II.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PSBP

CGSNL Gene Name

PHOTOSYSTEM II SUBUNIT

Oryzabase Gene Symbol Synonym(s)

PsbP, OsPsbP, psbP

Oryzabase Gene Name Synonym(s)

PSII subunit PsbP, photosystem II subunit PsbP, Chloroplast 23 KD polypeptide of photosystem II, Oxygen-evolving enhancer protein 2

Transcript Evidence

AK104722 (DDBJ, Best hit)

Protein Evidence

O65103 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: photosynthesis (GO:0015979)

Cellular Component: photosystem II (GO:0009523)

Cellular Component: oxygen evolving complex (GO:0009654)

Cellular Component: extrinsic to membrane (GO:0019898)

Molecular Function: calcium ion binding (GO:0005509)

Functional domain (InterPro)

Photosystem II PsbP, oxygen evolving complex (IPR002683)

Twin-arginine translocation pathway, signal sequence (IPR006311)

Mog1/PsbP, alpha/beta/alpha sandwich (IPR016123)

Mog1/PsbP/DUF1795, alpha/beta/alpha sandwich (IPR016124)

Full-length cDNA

001-038-B02 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0141400-02)

Others

Oryzabase (9595)

Transcript

1078 bp

>Os07t0141400-02 Similar to 23 kDa polypeptide of photosystem II.
ACACTACACCCCGCTCCACTCTCAGGCAGGCAATCAGCGGCGAGGCACCAGCCCACCGGC
CGGCAATGGCGTCCACCTCCTGCTTCCTCCACCAGTCCACGGCCCGCGTCGCCGCGCGCG
TCGCCTCCCCGTCCCCGGCGACACGGACCCACCTCCTCGTCTGCCGCGCCCAGAAGCAGG
ACGACGCCGACGTCTCCCGCCGCGCGGCGCTCGCGCTGCTGGCCGGAGCGACGGCGGCGG
TGGGGGTGAAGGTGGCGCCCGCCGCCGCGGCCTACGGCGAGGCGGCGAACGTGTTCGGGA
AGCCCAAGACGAACACGGAGTTCATCGCCTACAGCGGCGAGGGGTTCAAGCTGCTGATCC
CGTCCAAGTGGAACCCCAGCAAGGAGCGCGAGTTCCCCGGACAGGTCCTCCGCTACGAGG
ACAACTTCGACGCCAACAGCAACGTCTCCGTCATAATCAACCCCACCACCAAGAAGACCA
TCACCGAGTTCGGCTCCCCCGAGGAGTTCCTCGCCCAGGTCGACTTCTTGCTTGGCAAGC
AGGCCTACTCCGGCAAGACAGATTCCGAGGGTGGGTTTGAGTCGGACGCGGTGGCGACGG
CGAACATCCTGGAGAGCTCGGCGCCGGTGGTGGGAGGGAAGCAGTACTACAGCGTAACGG
TGCTGACGAGGACGGCGGACGGCGACGAGGGCGGCAAGCACCAGCTGATCACGGCCACCG
TCAACGACGGCAAGCTGTACATCTGCAAGGCGCAGGCCGGCGACAAGAGGTGGTTCAAGG
GCGCCAGGAAGTTCGTCGAGAGCGCAGCCAGCTCCTTCAGCGTCGCATGATCGTCGAAAT
CTCTATCTCAGCTTCTCTTTAATCCCTAGCGAATCAAAATCAAATCAATCGAGTTCGTTG
CTCAGAGAGATGCAGTGCACGCATGTGTGTGTGCGTGTGTGTTTCTTTGATTGTACATGA
GAATTAAGAACAAGTTAAGGAGAGAGGTCGATCCATCGATTTCCCCTGCATGCAAGGATT
GATTTTCTGTGATCCGTGTGTTAAGTAATCCTAGTAATTAATCATGTTTCATTTTTGT

CDS

765 bp

>Os07t0141400-02 Similar to 23 kDa polypeptide of photosystem II.
ATGGCGTCCACCTCCTGCTTCCTCCACCAGTCCACGGCCCGCGTCGCCGCGCGCGTCGCC
TCCCCGTCCCCGGCGACACGGACCCACCTCCTCGTCTGCCGCGCCCAGAAGCAGGACGAC
GCCGACGTCTCCCGCCGCGCGGCGCTCGCGCTGCTGGCCGGAGCGACGGCGGCGGTGGGG
GTGAAGGTGGCGCCCGCCGCCGCGGCCTACGGCGAGGCGGCGAACGTGTTCGGGAAGCCC
AAGACGAACACGGAGTTCATCGCCTACAGCGGCGAGGGGTTCAAGCTGCTGATCCCGTCC
AAGTGGAACCCCAGCAAGGAGCGCGAGTTCCCCGGACAGGTCCTCCGCTACGAGGACAAC
TTCGACGCCAACAGCAACGTCTCCGTCATAATCAACCCCACCACCAAGAAGACCATCACC
GAGTTCGGCTCCCCCGAGGAGTTCCTCGCCCAGGTCGACTTCTTGCTTGGCAAGCAGGCC
TACTCCGGCAAGACAGATTCCGAGGGTGGGTTTGAGTCGGACGCGGTGGCGACGGCGAAC
ATCCTGGAGAGCTCGGCGCCGGTGGTGGGAGGGAAGCAGTACTACAGCGTAACGGTGCTG
ACGAGGACGGCGGACGGCGACGAGGGCGGCAAGCACCAGCTGATCACGGCCACCGTCAAC
GACGGCAAGCTGTACATCTGCAAGGCGCAGGCCGGCGACAAGAGGTGGTTCAAGGGCGCC
AGGAAGTTCGTCGAGAGCGCAGCCAGCTCCTTCAGCGTCGCATGA

Protein

255 aa

>Os07t0141400-02 Similar to 23 kDa polypeptide of photosystem II.
MASTSCFLHQSTARVAARVASPSPATRTHLLVCRAQKQDDADVSRRAALALLAGATAAVG
VKVAPAAAAYGEAANVFGKPKTNTEFIAYSGEGFKLLIPSKWNPSKEREFPGQVLRYEDN
FDANSNVSVIINPTTKKTITEFGSPEEFLAQVDFLLGKQAYSGKTDSEGGFESDAVATAN
ILESSAPVVGGKQYYSVTVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGA
RKFVESAASSFSVA*

5'UTR

chr07:2138230..2138294 (- strand) : 65 bp

CDS

chr07:2137777..2138229 (- strand) : 453 bp

chr07:2137626..2137676 (- strand) : 51 bp

chr07:2137119..2137379 (- strand) : 261 bp

3'UTR

chr07:2136871..2137118 (- strand) : 248 bp

FASTA

>Os07t0141400-02 class=Sequence position=chr07:2136871..2138294 (- strand)
ACACTACACC CCGCTCCACT CTCAGGCAGG CAATCAGCGG CGAGGCACCA GCCCACCGGC CGGCAATGGC GTCCACCTCC
TGCTTCCTCC ACCAGTCCAC GGCCCGCGTC GCCGCGCGCG TCGCCTCCCC GTCCCCGGCG ACACGGACCC ACCTCCTCGT
CTGCCGCGCC CAGAAGCAGG ACGACGCCGA CGTCTCCCGC CGCGCGGCGC TCGCGCTGCT GGCCGGAGCG ACGGCGGCGG
TGGGGGTGAA GGTGGCGCCC GCCGCCGCGG CCTACGGCGA GGCGGCGAAC GTGTTCGGGA AGCCCAAGAC GAACACGGAG
TTCATCGCCT ACAGCGGCGA GGGGTTCAAG CTGCTGATCC CGTCCAAGTG GAACCCCAGC AAGGAGCGCG AGTTCCCCGG
ACAGGTCCTC CGCTACGAGG ACAACTTCGA CGCCAACAGC AACGTCTCCG TCATAATCAA CCCCACCACC AAGAAGACCA
TCACCGAGTT CGGCTCCCCC GAGGAGTTCC TCGCCCAGGT AAATAAAAAA AAATATTTTA TCGTTTTAGA CATTGACACG
GTCTCTCTAT AAGATAAAGT AGAAATAGTT CTGAATTAAC GATTGCTTTC TTGTTCAGGT CGACTTCTTG CTTGGCAAGC
AGGCCTACTC CGGCAAGACA GATTCCGAGG TAACGTATTT GATGTTCGAG ACAGGATTTG GTCAAACTTT TCGAAACTTT
ACATACATGA GAATGCTATA GTACGCTATC ATGTTCAGAC AGGATGATAT CTCGTAGTTA TCGGCTGATA CGGTATCATC
CCGTCCGAAC AAGGTATCAG ACATCTTGTT CGAACGGGAT ATCGTCTTGT AGTATTTCCC TTTAAATATG ATGTTTTTGC
GAGAATGTGT TGTGATGTGT GGATATGCGA TATAGGGTGG GTTTGAGTCG GACGCGGTGG CGACGGCGAA CATCCTGGAG
AGCTCGGCGC CGGTGGTGGG AGGGAAGCAG TACTACAGCG TAACGGTGCT GACGAGGACG GCGGACGGCG ACGAGGGCGG
CAAGCACCAG CTGATCACGG CCACCGTCAA CGACGGCAAG CTGTACATCT GCAAGGCGCA GGCCGGCGAC AAGAGGTGGT
TCAAGGGCGC CAGGAAGTTC GTCGAGAGCG CAGCCAGCTC CTTCAGCGTC GCATGATCGT CGAAATCTCT ATCTCAGCTT
CTCTTTAATC CCTAGCGAAT CAAAATCAAA TCAATCGAGT TCGTTGCTCA GAGAGATGCA GTGCACGCAT GTGTGTGTGC
GTGTGTGTTT CTTTGATTGT ACATGAGAAT TAAGAACAAG TTAAGGAGAG AGGTCGATCC ATCGATTTCC CCTGCATGCA
AGGATTGATT TTCTGTGATC CGTGTGTTAA GTAATCCTAG TAATTAATCA TGTTTCATTT TTGT