Os07t0153000-01

Locus

Os07g0153000

Description

A member of the JASMONATE ZIM-domain (JAZ) family

RAP-DB Gene Symbol Synonym(s)

OsJAZ2, OsTIFY5

RAP-DB Gene Name Synonym(s)

Jasmonate ZIM-domain protein 2

CGSNL Gene Symbol

TIFY5

CGSNL Gene Name

TIFY GENE 5

Oryzabase Gene Symbol Synonym(s)

OsJAZ 2, OsJAZ2, JAZ2, OsTIFY5, OsSTA188

Oryzabase Gene Name Synonym(s)

Jasmonate ZIM-domain protein 2

Transcript Evidence

Inferred from literature

Protein Evidence

Q69NY7

Literature

PMID: 19618278

Note

Manual Curation

July 8, 2020

Functional domain (InterPro)

Tify domain (IPR010399)

CO/COL/TOC1, conserved site (IPR018467)

Expression Databases

TENOR (Os07t0153000-00)

Others

Oryzabase (15072)

Transcript

789 bp

>Os07t0153000-01 A member of the JASMONATE ZIM-domain (JAZ) family
TGATAACAAGACGACCACCACCAATCGCCGGAGGTGGAGAAGACGACGACGTACGACGAA
TTGGCTATAGCTAGCTAGCTAGCTGATTGATCCACCGATCGATCGAAGAGGAAGAAGAAG
AATTGATCGATCGATCGATTGATTGATCGATTGATCAGAGAGGAAGAAGAATTTGATTGA
TCGATCGACGACGAAGCTATATATATAGTCGTCGGATTGATCGATCGATCGATGGCGGAG
GAGCGGAGGAGAGACGACGGCGGCGACGTGGAGGTGGAGCTGAGCCTCCGGCTGAGGACC
GGGGACGACAGTACAAGTGCTGACCCGGCGCCGGCGACGGTGGCGGCGGAGGCGAGGAGG
AACTTGACCATCTTCTACAACGGCCGGATGTGCGCCGTCAACGTCACCGAGCTACAGGCG
AGGACGATCATATCCATGGCGAGCCAAGGAAATTTCGGCAAGCAGCAGCAGCAGCAAATA
CAGGGTAGGGACGATCACCACTACCACCAGGGCGAGAGCAGCAGCGGCGGCGGCGTTTCC
ACGGCGGCGGCGCGGCACTGCGACGTCGCCGGCAGCAGCAGCAGCCACAGCGGCAGCGGC
AGCGGCAGCGCGACGCCGCCCCGGCCGGCGCTGGTTTCTCCTCGCGCGGGCCTTCAGGCG
GCCGCGGCGGCGGCGCCGACGATGAACCAGCCGCCGGCGGCGAGCGGGCTGTCCATGAAG
CGGTCGCTGCAGCGATTCCTCGAGAAGAGGAAGACGAGGGCCGCCGCGCCGCTGTACGCC
CGGCGATAG

CDS

558 bp

>Os07t0153000-01 A member of the JASMONATE ZIM-domain (JAZ) family
ATGGCGGAGGAGCGGAGGAGAGACGACGGCGGCGACGTGGAGGTGGAGCTGAGCCTCCGG
CTGAGGACCGGGGACGACAGTACAAGTGCTGACCCGGCGCCGGCGACGGTGGCGGCGGAG
GCGAGGAGGAACTTGACCATCTTCTACAACGGCCGGATGTGCGCCGTCAACGTCACCGAG
CTACAGGCGAGGACGATCATATCCATGGCGAGCCAAGGAAATTTCGGCAAGCAGCAGCAG
CAGCAAATACAGGGTAGGGACGATCACCACTACCACCAGGGCGAGAGCAGCAGCGGCGGC
GGCGTTTCCACGGCGGCGGCGCGGCACTGCGACGTCGCCGGCAGCAGCAGCAGCCACAGC
GGCAGCGGCAGCGGCAGCGCGACGCCGCCCCGGCCGGCGCTGGTTTCTCCTCGCGCGGGC
CTTCAGGCGGCCGCGGCGGCGGCGCCGACGATGAACCAGCCGCCGGCGGCGAGCGGGCTG
TCCATGAAGCGGTCGCTGCAGCGATTCCTCGAGAAGAGGAAGACGAGGGCCGCCGCGCCG
CTGTACGCCCGGCGATAG

Protein

186 aa

>Os07t0153000-01 A member of the JASMONATE ZIM-domain (JAZ) family
MAEERRRDDGGDVEVELSLRLRTGDDSTSADPAPATVAAEARRNLTIFYNGRMCAVNVTE
LQARTIISMASQGNFGKQQQQQIQGRDDHHYHQGESSSGGGVSTAAARHCDVAGSSSSHS
GSGSGSATPPRPALVSPRAGLQAAAAAAPTMNQPPAASGLSMKRSLQRFLEKRKTRAAAP
LYARR*

5'UTR

chr07:2803979..2804209 (- strand) : 231 bp

CDS

chr07:2803793..2803978 (- strand) : 186 bp

chr07:2801928..2802299 (- strand) : 372 bp

FASTA

>Os07t0153000-01 class=Sequence position=chr07:2801928..2804209 (- strand)
TGATAACAAG ACGACCACCA CCAATCGCCG GAGGTGGAGA AGACGACGAC GTACGACGAA TTGGCTATAG CTAGCTAGCT
AGCTGATTGA TCCACCGATC GATCGAAGAG GAAGAAGAAG AATTGATCGA TCGATCGATT GATTGATCGA TTGATCAGAG
AGGAAGAAGA ATTTGATTGA TCGATCGACG ACGAAGCTAT ATATATAGTC GTCGGATTGA TCGATCGATC GATGGCGGAG
GAGCGGAGGA GAGACGACGG CGGCGACGTG GAGGTGGAGC TGAGCCTCCG GCTGAGGACC GGGGACGACA GTACAAGTGC
TGACCCGGCG CCGGCGACGG TGGCGGCGGA GGCGAGGAGG AACTTGACCA TCTTCTACAA CGGCCGGATG TGCGCCGTCA
ACGTCACCGA GCTACAGGTA ATTAATTAAT TTAATTAATT TGGGTTTCCT GATCATTCAT TTCGATCAAC ATCTGTTAAT
CTCTCTGGAT TTTCGTGTTC TTATTATGAT CATCGATCGT CTAATTACCA GCCTGGATCT ATAGATCACT ACTAACAAAT
TAATTAACAA ACCTAAAAAA ATTAATTAAC CCCTTTTTTA GGGAGATCTC TGAACTTAGT TAATTAACCT CATTGTTGAT
ATATAGCATT CTGACAGCTG GTTATGGGAT GGGAAATGTT ATTTGTTCCT CATCCTAGCT ATATCTAGCT TATTTCCCCA
AACAAATGAA ACTTTAATTA GCTCAAGCAT ATACACATAT ATGATTTTTA TTTTTAATAA CGAAATGCGT CTATATATAG
TTCAAATAAC CTTGGGATAG AAGCATTAAG AGGAATGCTA ATATCTCCCT TGATTTACTT CCTAGCTTAT TCCGTTTTGC
AAAGTCTAGA CCTCTACTAA TATCCAAATT AACTTGAAGT TTAGCTCACT CCAATCTGTC AATTTCAAGT TCACAGCAGT
ATCTCCGTTA TCATTTCTCG TATTTAGGCT GTGTAGATAC ACAAAACAAT ATGTTCACAA ACTATATACA TATTATCAAT
TTTTTAATTA ATTAATTAAC ACACCAAAAT TTGGTCTCCA TCTAGATTAG TTAATTAACA GGGGTAGGTC CAACAGCATG
GTTGAAACTT GAAGATTCTT ACTACTGAAC AATTTATACC ACGTGTTGTA CCAAATCAAG GGGACAGAAC AAAAGTAAAG
ACTTACTGTA GAACACTAGT CTACCTTTAG CTGGTGGCTG CGTCATTGAC CAATTAATAA TAATTAACGC GGAATTAATA
ATGCATACCT ATCATATGCA AGCACGTTGT TTTGCTGGGC TCCCCGGCAA ACCAAGCAGC TAGGTAGTGA GAACACACCT
CAATTCATTA ATTTAGACTT GACCAACTAA AACAATGTTA GTTTTGGTCT TAATCCATCG CTGTCGCCAG CACAAACTAA
CATTTATATA TTCACAAAAG CAACCACTTT GCTCACCGAT GCTTTTGACT CTGATAGATT CATGCAATCC ATATCGTTGA
TTTGATCTAC TCCTGTCGAC ATGAGATATT TTCACGACAA CAAATAGAGT ACATGtactc tcgcattttt taatatatgg
tgttgttaac attttagata tgttaatttg atccttcatt ttattaaaaa aaatatataa ttatgattta gtttattatg
atttgattct ttaagcctga tttaatttat tttatactta cataaatttt taaaaattga aataagacga atggtcaagt
atttataaaa aaataatggt gtcatatatt aaaaagtgta ggtactaTTG GTAATAACTG ATTAGTGTTT TGTTGTGCAT
TTTGTAATTT CAAGTAATGA TTAAATTATT CGGTTTGATT TTTGTGTTCT GATTGATTTA TGGCATCCAG GCGAGGACGA
TCATATCCAT GGCGAGCCAA GGAAATTTCG GCAAGCAGCA GCAGCAGCAA ATACAGGGTA GGGACGATCA CCACTACCAC
CAGGGCGAGA GCAGCAGCGG CGGCGGCGTT TCCACGGCGG CGGCGCGGCA CTGCGACGTC GCCGGCAGCA GCAGCAGCCA
CAGCGGCAGC GGCAGCGGCA GCGCGACGCC GCCCCGGCCG GCGCTGGTTT CTCCTCGCGC GGGCCTTCAG GCGGCCGCGG
CGGCGGCGCC GACGATGAAC CAGCCGCCGG CGGCGAGCGG GCTGTCCATG AAGCGGTCGC TGCAGCGATT CCTCGAGAAG
AGGAAGACGA GGGCCGCCGC GCCGCTGTAC GCCCGGCGAT AG

Locus: Os07g0153000

Loading...

Locus: Os07g0153000

Loading...