Os07t0155600-01

Locus

Os07g0155600

Description

Nramp ion-transporter family protein, Ethylene signaling pathway

RAP-DB Gene Symbol Synonym(s)

EIN2, OsEIN2

RAP-DB Gene Name Synonym(s)

ETHYLENE-INSENSITIVE PROTEIN 2, Ethylene-insensitive protein 2

CGSNL Gene Symbol

EIN2

CGSNL Gene Name

ETHYLENE-INSENSITIVE PROTEIN 2

Oryzabase Gene Symbol Synonym(s)

OsEIN2, MHZ7/OsEIN2, OsEIN2/MHZ7, MHZ7

Oryzabase Gene Name Synonym(s)

Ethylene-insensitive protein 2, maohuzi7, maohuzi 7

Transcript Evidence

AY396568 (DDBJ)

Protein Evidence

Q6TJY0 (UniProt)

Q0D8I9 (UniProt)

Literature

PMID: 15047876

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

July 26, 2010

Gene Ontology (GO)

Biological Process: transport (GO:0006810)

Cellular Component: membrane (GO:0016020)

Molecular Function: transporter activity (GO:0005215)

Functional domain (InterPro)

Natural resistance-associated macrophage protein (IPR001046)

Ethylene-insensitive 2 (IPR017187)

Expression Databases

TENOR (Os07t0155600-01)

Others

Oryzabase (3070)

Transcript

4598 bp

>Os07t0155600-01 Nramp ion-transporter family protein, Ethylene signaling pathway
ATCCATCTCGAGTTCGATTGGGGTTTTTTTTTTCTCTCTTGAGGTTGCTGGTGATGAGCT
TCACTTTCTTGGATTGATTTTTTTTTTGTTCTTGTTCGTTGAGTTTTTCACTTTGCTCTA
ATCCAAATCTTTTTTTTCTCTCTCTCTCTCTCTAATATCCATAATTAATCTGCAGATTTC
CATGATTGGTGGTGGAGTTCATCGGCAAGGAATTCAGCAGAAGAGATCAGATTCTGTACA
CAGTTCGTCTTCTTGCTCGGTGACTAAGCTGGGTTAGGAGAGGAGGAAAAGAAAATCTTT
TTTTTTTTTTTTGCGGCGCCATGGATGGGCAGCAGCTACGTAGCTCGGAATCTCCGGCGA
GCGGCGGCGGCGGAGTCACCGGCGGCGGCGCGCCACATCTGTTCCACGCGCTCGGGCCGG
CGCTGCTGATCTCGATTGGGTACATTGACCTCGGGAAATGGGTGGCCGCGGTGGAGGCAG
GGTCACGGTTCGGCCTTGACCTCGTGCTGCTGGCCCTCCTCTTCAACTTCATGGCCATCC
TGTGCCAGTATCTCGCGGCTTGCATTGGCACGGTCACCGGGAGGAGCCTCGCCGAGATCT
GCCACCAAGAATACAGCAGGCCAACATGCATCTTTCTGGGTGTTCAAGCAGGATTGTCCT
TGTTGACATCAGAATTGACGATGATTTTTGGGATAGCACTTGGATTCAATCTTCTATTTG
AATATGATGATCTCATCACTGGGATATGTTTTGCAACCGTTGTTCCTAATCTGCTACCAT
ATGCTATATCACACCTGGGAAAGAAGATGGTGGGGACATTAAATGCTTGCATTGCAGGCT
TTGCGCTTCTTTGCTACGTTCTTGGTTTATTGGTCAGCCAACCACAAATTCCTCTGACAA
CGAATGTAATTTTCCCCAAGCTCAGTGGTGAAAGTGCTTATTCTCTGATGGCTCTTCTTG
GTGCAAACGTAATGGCACACAACTTTTACATCCATTCATCAGTTGTTCAGGGTCAGAAAA
GATCTGCCTTTGCTGTTGGTGCCTTATTTCATGATCACTTGTTTTCAGTATTATTTATTT
TTACTGGAATTTTTCTGGTGAATCATGTTCTAATGAACTCTGCAGCAGCTGATTCCACTA
ACACCCTTCTTCTCACCTTCCAAGATGTTGTAGAACTAATGAACCAGATATTTGTAAACC
CTATGGCTCCAACTATATTTCTAGTGGTTCTTCTCTTCTCTAGCCACATCATCTCGTTGA
CATCTGCTATTGGTAGCCAAGTGATTTCGCAGCATTTGTTTGGCATTAATCTTCCTCTCT
CTGGACATCATCTGATACTGAAGGCTTTTGCCATAGTTCCTGCTCTGTACTGTGCTAAGG
TTGCAGGTGCTGAAGGAATATACCAATTACTGATAATCTGCCAGATTATCCAGGCCATGC
TCCTTCCATCATCAGTCGTGCCACTCTTCCGTGTTGCCTCATCAAGATTGATAATGGGTG
CCCACAGAGTGTCTTTGCATCTGGAGATATTAACATTTCTTGCATTTCTCCTCATGCTGT
TTTCGAATATCATCTTTATGGCAGAAATGCTGTTTGGTGACAGTGGTTGGCTGAACACTC
TGAAAGGGAATACTGGAAGCCCTGTGGTGTTTCCATCTACGGTTCTCATCACGGTGGCTT
GTGTCTCTGTTGCATTTTCACTCTACATGGCTGTTACACCACTGAAATCAGGAAGCCATG
AAGCTGAATTGCAGCAGGAATGGTCTGTGCCTTCTCAGAAAGAGCTCTTGAATACTACTC
AAGACAGAGAAGAGACTTGTGCGGGCAATGTTACCTATGAGGAAGATCAGAGATCTGATG
TTGTCCCTTCTCCTAGGATTCAGCCTGTGGATTGTCTGAAATCAGCTCTGGACTACATTG
ATAGTTCGGACACAGCTATAGAATCTGATCATGATTCTCAACATTCCACTGCTCATACAT
CTACCGCTCCTGAATCCTGTCACTCTCCATCATTCATTCCTGAAGAGTCAAAATCAGTTG
TTGCTGTTGACTGGCCAGAGCCTCTGGAGCCAATTTCTAATGCTATTGTGGCTGAGGAAA
GTACAGTAGAGAGTGTGGACTCCAAGAGCACAGGCGAAAGGGATATTGAAGTAGAACCAG
CTCTTTTGATGGACAATGATAAGGAGGCTCCAAATATTCTAGAGTCTGACAACAAGCCAC
TTGGAGGCAATAATCCTTCCTGTGCATCGGATGATGGCCCACCATCTCTTACCTTCAGCA
GGGGGAAAGGCTCAGATGCAGGCAATGGCAGCGGGAGTCTCTCGAGGTTATCTGGTTTGG
GCCGTGCAGCAAGGAGGCAACTAGCAGCCATACTTGATGAGTTCTGGGGGCATCTCTTTG
ATTACCATGGGAAACTCACTCAAGAAGCTAGCTCTAAAAGGTTTGACATCTTGCTTGGGC
TAGACGTAAGAACACCTAGCTCAACTGTAAGAGCAGACAGTCAAGCTAATGAAATCCCGA
AGAGTCCCATGGTACGAGACAATTTACAAGGGTCTGCCTTCTTGGGAAGTTCAAGGGATC
TGATGTCTACTAAGAATGAGATGTCGAATTTGGATCTGACATATGGGCTTCAGATGGGCA
ATAACATTGGGTCATCAGCCTGGTCTCAGGGCATGCAGTTACCAAGTACCCAACTGCAGA
GTTCAAGCAACAGCTTACTCGATCAAGGTGCAAGATTAAATTCAAATTTTAGCACGCCAT
CATACGCAGACAACAACCAATTCTACCAACCTGCAACGATTCATGGGTATCAGCTCGCAT
CATACCTAAAACAGATGAATGCTAATCGAAATCCTTACTCTAGCATGCCATTGGACCCAC
AGCGACTTCCAAAATCTTCTGCATCGGCTGTGCCAACCTATGTCGATTCTGTCATGCATG
CTCGTAACCAGAACTTGCTTGCTTCATTGGGAGCTACTCCTTCACAGATCGCAGCAACAT
CCCGGATAGGTACTATGATGGCAGAAAGATCCTATTATGTCCCTTCCACTCTTGACGGGA
ATGAAAATGCTGGTTCATCAGCTTACTCAAAGAAGTACCACAGCTCACCAGACATATCTG
CACTGATTGCTGCAAGCAGGAGTGCTCTGTTGAATGAATCAAAGTTGGGTGGTGGTACCA
TTGGATCCCAGTCGTACCTTAGCAGGCTTGCATCGGAAAGATCTCAGTATACAAACTCGG
TGGCCAGGCCTGCAGCTCCCTTGGCGTTTGATGAGCTCTCTCCACCTAAGCTCCCAGGGG
ATATCTTCTCAATGCAACAAAGCCCAAACCCAAGTGCAAGATCCCTTTGGGCTAAGCAAC
CTTTTGAGCAGCTGTTTGGTGTGTCGAGTGCGGAGCTCACTAAAAGCGAGTTCAACCCTG
CAGGCAGATCGGGTGGCATGACCAAGGATGATTTCTCTTACAAGGAGTCTGAGGCGAAGC
TTCTTCAGTCTCTTAGATTCTGCATCTCGAAGCTCCTGAAGCTAGAAGGATCAGGGTGGC
TGTTCAAGCAAAATGGTGGCAGCGACGAAGATCTGATTGATCAAGTTGCTGCGGTAGAGA
AGCTATTGCAACAAGGAACCAGTGACAACCAACTGCTGCTTGGTGATACTCAGCAACCAC
CATGTGATAAGGCAGACATCCAGTACATGCGCGTACTGCCTAACTGCGGAGACGACTGCA
TCTGGCGCGCCTCCCTCGTTGTCAGCTTCGGTGTCTGGTGCATCCGCCGGGTGCTAGACC
TGTCTCTGGTGGAAAGCAGGCCAGAACTTTGGGGCAAGTATACCTATGTTCTCAACCGTC
TTCAGGGCATCCTGGATCCTGCATTCTCCAAGCCTCGGAGTGCTCTCAGCGCGTGTGCGT
GCCTTCACAGAGATATCCGGGTGCTCAACAGCCTGCGCCACAGTAGCCTGGTAGCAACAA
ACTCCATTCCAAGGCAAATCCGAGGTTCCTTCACCACCGCATCTGTGGTCCTGGAGATGA
TCAAGGATGTGGAGACCGCAGTCTCAGGGCGCAAGGGCAGGAGTGGCACCGCAGCTGGGG
ATGTCGCCTTCCCCAAGGGGAAGGAGAACCTGGCCTCCGTGCTGAAGCGATACAAGCGGA
GGCTCTCGAGCAAGGGACAACAATAATAAGGCATCTGGGCAGCGTGATCCTGTCGCGTTT
TAGGGGGACTTTGACCATTGTTCTTCAAGGATGGCAGCCAGCCATGGTGGCTTGCCCTCC
CTGAGCCCTGGATTTTTTCGTTGCACAACGTTTGCAGGGACCTGAGGAATTGGCCAACAC
TTCTGGTCCCTTCCATCATATTTCGTTTTTTTTTGTTTCTTTCTTGTTTTTTTTTTTTTT
TTTGCATGTGATGTGTTGTATAATGGTAACTGTTCATGTGCCAGAAGAACAACCACCAAA
ATGTACAACAGATGTAGTCAGCTGATGCACCATTGTAAAGTTTAGTCTCTGCATTTTAAC
CTTTTTTTTGGGGGTCATTGACAAACTGAATGAATGCCCTGTGTAATCTCTCTTCAGAGA
GGATGCCAAGACTGAGAAAAAGCTTTTGCCAGATTTCC

CDS

3846 bp

>Os07t0155600-01 Nramp ion-transporter family protein, Ethylene signaling pathway
ATGGATGGGCAGCAGCTACGTAGCTCGGAATCTCCGGCGAGCGGCGGCGGCGGAGTCACC
GGCGGCGGCGCGCCACATCTGTTCCACGCGCTCGGGCCGGCGCTGCTGATCTCGATTGGG
TACATTGACCTCGGGAAATGGGTGGCCGCGGTGGAGGCAGGGTCACGGTTCGGCCTTGAC
CTCGTGCTGCTGGCCCTCCTCTTCAACTTCATGGCCATCCTGTGCCAGTATCTCGCGGCT
TGCATTGGCACGGTCACCGGGAGGAGCCTCGCCGAGATCTGCCACCAAGAATACAGCAGG
CCAACATGCATCTTTCTGGGTGTTCAAGCAGGATTGTCCTTGTTGACATCAGAATTGACG
ATGATTTTTGGGATAGCACTTGGATTCAATCTTCTATTTGAATATGATGATCTCATCACT
GGGATATGTTTTGCAACCGTTGTTCCTAATCTGCTACCATATGCTATATCACACCTGGGA
AAGAAGATGGTGGGGACATTAAATGCTTGCATTGCAGGCTTTGCGCTTCTTTGCTACGTT
CTTGGTTTATTGGTCAGCCAACCACAAATTCCTCTGACAACGAATGTAATTTTCCCCAAG
CTCAGTGGTGAAAGTGCTTATTCTCTGATGGCTCTTCTTGGTGCAAACGTAATGGCACAC
AACTTTTACATCCATTCATCAGTTGTTCAGGGTCAGAAAAGATCTGCCTTTGCTGTTGGT
GCCTTATTTCATGATCACTTGTTTTCAGTATTATTTATTTTTACTGGAATTTTTCTGGTG
AATCATGTTCTAATGAACTCTGCAGCAGCTGATTCCACTAACACCCTTCTTCTCACCTTC
CAAGATGTTGTAGAACTAATGAACCAGATATTTGTAAACCCTATGGCTCCAACTATATTT
CTAGTGGTTCTTCTCTTCTCTAGCCACATCATCTCGTTGACATCTGCTATTGGTAGCCAA
GTGATTTCGCAGCATTTGTTTGGCATTAATCTTCCTCTCTCTGGACATCATCTGATACTG
AAGGCTTTTGCCATAGTTCCTGCTCTGTACTGTGCTAAGGTTGCAGGTGCTGAAGGAATA
TACCAATTACTGATAATCTGCCAGATTATCCAGGCCATGCTCCTTCCATCATCAGTCGTG
CCACTCTTCCGTGTTGCCTCATCAAGATTGATAATGGGTGCCCACAGAGTGTCTTTGCAT
CTGGAGATATTAACATTTCTTGCATTTCTCCTCATGCTGTTTTCGAATATCATCTTTATG
GCAGAAATGCTGTTTGGTGACAGTGGTTGGCTGAACACTCTGAAAGGGAATACTGGAAGC
CCTGTGGTGTTTCCATCTACGGTTCTCATCACGGTGGCTTGTGTCTCTGTTGCATTTTCA
CTCTACATGGCTGTTACACCACTGAAATCAGGAAGCCATGAAGCTGAATTGCAGCAGGAA
TGGTCTGTGCCTTCTCAGAAAGAGCTCTTGAATACTACTCAAGACAGAGAAGAGACTTGT
GCGGGCAATGTTACCTATGAGGAAGATCAGAGATCTGATGTTGTCCCTTCTCCTAGGATT
CAGCCTGTGGATTGTCTGAAATCAGCTCTGGACTACATTGATAGTTCGGACACAGCTATA
GAATCTGATCATGATTCTCAACATTCCACTGCTCATACATCTACCGCTCCTGAATCCTGT
CACTCTCCATCATTCATTCCTGAAGAGTCAAAATCAGTTGTTGCTGTTGACTGGCCAGAG
CCTCTGGAGCCAATTTCTAATGCTATTGTGGCTGAGGAAAGTACAGTAGAGAGTGTGGAC
TCCAAGAGCACAGGCGAAAGGGATATTGAAGTAGAACCAGCTCTTTTGATGGACAATGAT
AAGGAGGCTCCAAATATTCTAGAGTCTGACAACAAGCCACTTGGAGGCAATAATCCTTCC
TGTGCATCGGATGATGGCCCACCATCTCTTACCTTCAGCAGGGGGAAAGGCTCAGATGCA
GGCAATGGCAGCGGGAGTCTCTCGAGGTTATCTGGTTTGGGCCGTGCAGCAAGGAGGCAA
CTAGCAGCCATACTTGATGAGTTCTGGGGGCATCTCTTTGATTACCATGGGAAACTCACT
CAAGAAGCTAGCTCTAAAAGGTTTGACATCTTGCTTGGGCTAGACGTAAGAACACCTAGC
TCAACTGTAAGAGCAGACAGTCAAGCTAATGAAATCCCGAAGAGTCCCATGGTACGAGAC
AATTTACAAGGGTCTGCCTTCTTGGGAAGTTCAAGGGATCTGATGTCTACTAAGAATGAG
ATGTCGAATTTGGATCTGACATATGGGCTTCAGATGGGCAATAACATTGGGTCATCAGCC
TGGTCTCAGGGCATGCAGTTACCAAGTACCCAACTGCAGAGTTCAAGCAACAGCTTACTC
GATCAAGGTGCAAGATTAAATTCAAATTTTAGCACGCCATCATACGCAGACAACAACCAA
TTCTACCAACCTGCAACGATTCATGGGTATCAGCTCGCATCATACCTAAAACAGATGAAT
GCTAATCGAAATCCTTACTCTAGCATGCCATTGGACCCACAGCGACTTCCAAAATCTTCT
GCATCGGCTGTGCCAACCTATGTCGATTCTGTCATGCATGCTCGTAACCAGAACTTGCTT
GCTTCATTGGGAGCTACTCCTTCACAGATCGCAGCAACATCCCGGATAGGTACTATGATG
GCAGAAAGATCCTATTATGTCCCTTCCACTCTTGACGGGAATGAAAATGCTGGTTCATCA
GCTTACTCAAAGAAGTACCACAGCTCACCAGACATATCTGCACTGATTGCTGCAAGCAGG
AGTGCTCTGTTGAATGAATCAAAGTTGGGTGGTGGTACCATTGGATCCCAGTCGTACCTT
AGCAGGCTTGCATCGGAAAGATCTCAGTATACAAACTCGGTGGCCAGGCCTGCAGCTCCC
TTGGCGTTTGATGAGCTCTCTCCACCTAAGCTCCCAGGGGATATCTTCTCAATGCAACAA
AGCCCAAACCCAAGTGCAAGATCCCTTTGGGCTAAGCAACCTTTTGAGCAGCTGTTTGGT
GTGTCGAGTGCGGAGCTCACTAAAAGCGAGTTCAACCCTGCAGGCAGATCGGGTGGCATG
ACCAAGGATGATTTCTCTTACAAGGAGTCTGAGGCGAAGCTTCTTCAGTCTCTTAGATTC
TGCATCTCGAAGCTCCTGAAGCTAGAAGGATCAGGGTGGCTGTTCAAGCAAAATGGTGGC
AGCGACGAAGATCTGATTGATCAAGTTGCTGCGGTAGAGAAGCTATTGCAACAAGGAACC
AGTGACAACCAACTGCTGCTTGGTGATACTCAGCAACCACCATGTGATAAGGCAGACATC
CAGTACATGCGCGTACTGCCTAACTGCGGAGACGACTGCATCTGGCGCGCCTCCCTCGTT
GTCAGCTTCGGTGTCTGGTGCATCCGCCGGGTGCTAGACCTGTCTCTGGTGGAAAGCAGG
CCAGAACTTTGGGGCAAGTATACCTATGTTCTCAACCGTCTTCAGGGCATCCTGGATCCT
GCATTCTCCAAGCCTCGGAGTGCTCTCAGCGCGTGTGCGTGCCTTCACAGAGATATCCGG
GTGCTCAACAGCCTGCGCCACAGTAGCCTGGTAGCAACAAACTCCATTCCAAGGCAAATC
CGAGGTTCCTTCACCACCGCATCTGTGGTCCTGGAGATGATCAAGGATGTGGAGACCGCA
GTCTCAGGGCGCAAGGGCAGGAGTGGCACCGCAGCTGGGGATGTCGCCTTCCCCAAGGGG
AAGGAGAACCTGGCCTCCGTGCTGAAGCGATACAAGCGGAGGCTCTCGAGCAAGGGACAA
CAATAA

Protein

1282 aa

>Os07t0155600-01 Nramp ion-transporter family protein, Ethylene signaling pathway
MDGQQLRSSESPASGGGGVTGGGAPHLFHALGPALLISIGYIDLGKWVAAVEAGSRFGLD
LVLLALLFNFMAILCQYLAACIGTVTGRSLAEICHQEYSRPTCIFLGVQAGLSLLTSELT
MIFGIALGFNLLFEYDDLITGICFATVVPNLLPYAISHLGKKMVGTLNACIAGFALLCYV
LGLLVSQPQIPLTTNVIFPKLSGESAYSLMALLGANVMAHNFYIHSSVVQGQKRSAFAVG
ALFHDHLFSVLFIFTGIFLVNHVLMNSAAADSTNTLLLTFQDVVELMNQIFVNPMAPTIF
LVVLLFSSHIISLTSAIGSQVISQHLFGINLPLSGHHLILKAFAIVPALYCAKVAGAEGI
YQLLIICQIIQAMLLPSSVVPLFRVASSRLIMGAHRVSLHLEILTFLAFLLMLFSNIIFM
AEMLFGDSGWLNTLKGNTGSPVVFPSTVLITVACVSVAFSLYMAVTPLKSGSHEAELQQE
WSVPSQKELLNTTQDREETCAGNVTYEEDQRSDVVPSPRIQPVDCLKSALDYIDSSDTAI
ESDHDSQHSTAHTSTAPESCHSPSFIPEESKSVVAVDWPEPLEPISNAIVAEESTVESVD
SKSTGERDIEVEPALLMDNDKEAPNILESDNKPLGGNNPSCASDDGPPSLTFSRGKGSDA
GNGSGSLSRLSGLGRAARRQLAAILDEFWGHLFDYHGKLTQEASSKRFDILLGLDVRTPS
STVRADSQANEIPKSPMVRDNLQGSAFLGSSRDLMSTKNEMSNLDLTYGLQMGNNIGSSA
WSQGMQLPSTQLQSSSNSLLDQGARLNSNFSTPSYADNNQFYQPATIHGYQLASYLKQMN
ANRNPYSSMPLDPQRLPKSSASAVPTYVDSVMHARNQNLLASLGATPSQIAATSRIGTMM
AERSYYVPSTLDGNENAGSSAYSKKYHSSPDISALIAASRSALLNESKLGGGTIGSQSYL
SRLASERSQYTNSVARPAAPLAFDELSPPKLPGDIFSMQQSPNPSARSLWAKQPFEQLFG
VSSAELTKSEFNPAGRSGGMTKDDFSYKESEAKLLQSLRFCISKLLKLEGSGWLFKQNGG
SDEDLIDQVAAVEKLLQQGTSDNQLLLGDTQQPPCDKADIQYMRVLPNCGDDCIWRASLV
VSFGVWCIRRVLDLSLVESRPELWGKYTYVLNRLQGILDPAFSKPRSALSACACLHRDIR
VLNSLRHSSLVATNSIPRQIRGSFTTASVVLEMIKDVETAVSGRKGRSGTAAGDVAFPKG
KENLASVLKRYKRRLSSKGQQ*

5'UTR

chr07:2984428..2984747 (+ strand) : 320 bp

CDS

chr07:2984748..2985023 (+ strand) : 276 bp

chr07:2985566..2985652 (+ strand) : 87 bp

chr07:2985774..2985887 (+ strand) : 114 bp

chr07:2985986..2986198 (+ strand) : 213 bp

chr07:2987064..2987240 (+ strand) : 177 bp

chr07:2987359..2990016 (+ strand) : 2658 bp

chr07:2990159..2990479 (+ strand) : 321 bp

3'UTR

chr07:2990480..2990911 (+ strand) : 432 bp

FASTA

>Os07t0155600-01 class=Sequence position=chr07:2984428..2990911 (+ strand)
ATCCATCTCG AGTTCGATTG GGGTTTTTTT TTTCTCTCTT GAGGTTGCTG GTGATGAGCT TCACTTTCTT GGATTGATTT
TTTTTTTGTT CTTGTTCGTT GAGTTTTTCA CTTTGCTCTA ATCCAAATCT TTTTTTTCTC TCTCTCTCTC TCTAATATCC
ATAATTAATC TGCAGATTTC CATGATTGGT GGTGGAGTTC ATCGGCAAGG AATTCAGCAG AAGAGATCAG ATTCTGTACA
CAGTTCGTCT TCTTGCTCGG TGACTAAGCT GGGTTAGGAG AGGAGGAAAA GAAAATCTTT TTTTTTTTTT TTGCGGCGCC
ATGGATGGGC AGCAGCTACG TAGCTCGGAA TCTCCGGCGA GCGGCGGCGG CGGAGTCACC GGCGGCGGCG CGCCACATCT
GTTCCACGCG CTCGGGCCGG CGCTGCTGAT CTCGATTGGG TACATTGACC TCGGGAAATG GGTGGCCGCG GTGGAGGCAG
GGTCACGGTT CGGCCTTGAC CTCGTGCTGC TGGCCCTCCT CTTCAACTTC ATGGCCATCC TGTGCCAGTA TCTCGCGGCT
TGCATTGGCA CGGTCACCGG GAGGAGCCTC GCCGAGGTAT TTCGAGATGC TTCTCACCTG ATGTTTTTGT TTTGTCTGAT
TTTGTAGTGG TGAATGATTC ATCATCATCC TCATCATCGT CAGTCAATTG ATCGACATCG GTTTGTCGTT TCGCAAATGG
TAGAAATGAT GATGGGTTTT TGATACTGAA TTGAGCCTCT GAGCGAATTC TGATGAGTAG GAAAAGCATC TTCATAATGA
AGGTCCTAAA TCTCGTATGT GAATTCCTGT TGATAAAGAA AATGATGGTT CACTTGGAAC TATACTTGTG CAAAAGAATC
CTATTCTTTT TTTTTTGGTG CCCTTATGGT GTATATGTTG TGATAGTAAA CAAAGAAAGG AGGTGTTTTG TTTTCGGAAA
TGGTGGAAAA GGAACTTTTG CTCATCTCAA GTTCCCTTTC TAGCTGGCCA TTTTGCGGAG GGGGAAAAAC CAACTTTCCC
TGTAAAACAG TGTGCTTTGA TCCTTCTATG TTATTCGTTT TGTTCGTGAA ATTCTTTCGA GGTTGCTGAC ATTTTTGTGT
TTTCCACATG GAACAAAGAT CTGCCACCAA GAATACAGCA GGCCAACATG CATCTTTCTG GGTGTTCAAG CAGGATTGTC
CTTGTTGACA TCAGAATTGA CGATGGTATT TTCAGCCTCT TCTCTTTTCG ATATTTAATA TGAGATCTGA GCCTGAGAAA
TTTCAGCCAT AAATGCTGCA TGTTTTGCAC ATGCTTTGTT CTGATTGTAA TATCTGGCAA TTTCAGATTT TTGGGATAGC
ACTTGGATTC AATCTTCTAT TTGAATATGA TGATCTCATC ACTGGGATAT GTTTTGCAAC CGTTGTTCCT AATCTGCTAC
CATATGCTAT ATCACACCTG GTAAAGAAGA AGATTATCTC ATATAGAAAA CTTCAAACCT ATATTGTAAT CTGATTTGGA
GTTAATATTT GTCAATTACT TTCATATACC TATTCTAGGG AAAGAAGATG GTGGGGACAT TAAATGCTTG CATTGCAGGC
TTTGCGCTTC TTTGCTACGT TCTTGGTTTA TTGGTCAGCC AACCACAAAT TCCTCTGACA ACGAATGTAA TTTTCCCCAA
GCTCAGTGGT GAAAGTGCTT ATTCTCTGAT GGCTCTTCTT GGTGCAAACG TAATGGCACA CAACTTTTAC ATCCATTCAT
CAGTTGTTCA GGTAAATTAT GATGCTTCTT TGTGCCCATT ACATAGTTAG AATTATATTT GATTTGATGC ATTTGGGGTG
AGGGGGGTTT GGGCATTTGG TGGACAATGG TCAATGGCAT GCCACAATTA TTTACACCAC ACAATGACAC ATGTTGCTAG
CTTTGCTAGT GTTTCGAACA GTTCAGAAAT TCCAAACTGA TAGCAAGGGT CACTATATTA GACTAGTTAT ACCAGTCTAA
TATCGGATGT AGTGGAGAAT GTTTTTGTTC TAATAGATCC AGTGGTTTGT GGGTACGCTG TATCCAACTG AAAAAGATAT
GGTTTGTCCT ATTTCAATTG TTTGCGCAGA GTTGAAGTGA TGTTCATTGA CTTAATTTCA AAACACCAAG ATACATCTTC
TAGCGAATTG CAGCATTATG TTAGGCATGC TCATCGTTAG TTAGTGAAAG AATTTGTTCT CACTTAATCC AGTTTGGAGC
TTAACTAACA ATTATGGCCA ATGAAACTAT AGTATTTAAT AAGCTATTGT GCCACATGCG GAATACTATT TCTGATTGAC
AAGCACAAAT CTAGAATGTT CCTTGAGTAA ATGTTTGTTC CCTAAAACTG TGGCCTATTT CTATTTGTTT TCTTTTTTAC
TTTCGCGTGT ACATATTTTG GTTCACTAAT GGTAAGTGTC TAGTGTTCAT GAGGTCTTTG CCTTAGGTTT GCTAGTATAT
GATATATATA TTACCTAAAG TGTATAAAAA TGGATAGCAT TAGTGAGTTT GACAGCAAAA CCAGCTACAT TTCATTGCCC
TTTGTGTCTT ATGCTTTTGG TTGTCTTTTT TTTTCAGCTT GTATCCATGT TTGCTAATCA AATAATCTCT TTTCAGGGTC
AGAAAAGATC TGCCTTTGCT GTTGGTGCCT TATTTCATGA TCACTTGTTT TCAGTATTAT TTATTTTTAC TGGAATTTTT
CTGGTGAATC ATGTTCTAAT GAACTCTGCA GCAGCTGATT CCACTAACAC CCTTCTTCTC ACCTTCCAAG ATGTTGTAGA
ACTAATGAAC CAGGTTAGTA CTATAGTTCC TACTACTTCA CCCTGTGATA TGCTAAGCTG GTGCTGAAGA AATCTTGTTT
CAGTAGCAAT CCTAAAGTGA TATACACTAC CTAACATTTA TCATTTTGCA GATATTTGTA AACCCTATGG CTCCAACTAT
ATTTCTAGTG GTTCTTCTCT TCTCTAGCCA CATCATCTCG TTGACATCTG CTATTGGTAG CCAAGTGATT TCGCAGCATT
TGTTTGGCAT TAATCTTCCT CTCTCTGGAC ATCATCTGAT ACTGAAGGCT TTTGCCATAG TTCCTGCTCT GTACTGTGCT
AAGGTTGCAG GTGCTGAAGG AATATACCAA TTACTGATAA TCTGCCAGAT TATCCAGGCC ATGCTCCTTC CATCATCAGT
CGTGCCACTC TTCCGTGTTG CCTCATCAAG ATTGATAATG GGTGCCCACA GAGTGTCTTT GCATCTGGAG ATATTAACAT
TTCTTGCATT TCTCCTCATG CTGTTTTCGA ATATCATCTT TATGGCAGAA ATGCTGTTTG GTGACAGTGG TTGGCTGAAC
ACTCTGAAAG GGAATACTGG AAGCCCTGTG GTGTTTCCAT CTACGGTTCT CATCACGGTG GCTTGTGTCT CTGTTGCATT
TTCACTCTAC ATGGCTGTTA CACCACTGAA ATCAGGAAGC CATGAAGCTG AATTGCAGCA GGAATGGTCT GTGCCTTCTC
AGAAAGAGCT CTTGAATACT ACTCAAGACA GAGAAGAGAC TTGTGCGGGC AATGTTACCT ATGAGGAAGA TCAGAGATCT
GATGTTGTCC CTTCTCCTAG GATTCAGCCT GTGGATTGTC TGAAATCAGC TCTGGACTAC ATTGATAGTT CGGACACAGC
TATAGAATCT GATCATGATT CTCAACATTC CACTGCTCAT ACATCTACCG CTCCTGAATC CTGTCACTCT CCATCATTCA
TTCCTGAAGA GTCAAAATCA GTTGTTGCTG TTGACTGGCC AGAGCCTCTG GAGCCAATTT CTAATGCTAT TGTGGCTGAG
GAAAGTACAG TAGAGAGTGT GGACTCCAAG AGCACAGGCG AAAGGGATAT TGAAGTAGAA CCAGCTCTTT TGATGGACAA
TGATAAGGAG GCTCCAAATA TTCTAGAGTC TGACAACAAG CCACTTGGAG GCAATAATCC TTCCTGTGCA TCGGATGATG
GCCCACCATC TCTTACCTTC AGCAGGGGGA AAGGCTCAGA TGCAGGCAAT GGCAGCGGGA GTCTCTCGAG GTTATCTGGT
TTGGGCCGTG CAGCAAGGAG GCAACTAGCA GCCATACTTG ATGAGTTCTG GGGGCATCTC TTTGATTACC ATGGGAAACT
CACTCAAGAA GCTAGCTCTA AAAGGTTTGA CATCTTGCTT GGGCTAGACG TAAGAACACC TAGCTCAACT GTAAGAGCAG
ACAGTCAAGC TAATGAAATC CCGAAGAGTC CCATGGTACG AGACAATTTA CAAGGGTCTG CCTTCTTGGG AAGTTCAAGG
GATCTGATGT CTACTAAGAA TGAGATGTCG AATTTGGATC TGACATATGG GCTTCAGATG GGCAATAACA TTGGGTCATC
AGCCTGGTCT CAGGGCATGC AGTTACCAAG TACCCAACTG CAGAGTTCAA GCAACAGCTT ACTCGATCAA GGTGCAAGAT
TAAATTCAAA TTTTAGCACG CCATCATACG CAGACAACAA CCAATTCTAC CAACCTGCAA CGATTCATGG GTATCAGCTC
GCATCATACC TAAAACAGAT GAATGCTAAT CGAAATCCTT ACTCTAGCAT GCCATTGGAC CCACAGCGAC TTCCAAAATC
TTCTGCATCG GCTGTGCCAA CCTATGTCGA TTCTGTCATG CATGCTCGTA ACCAGAACTT GCTTGCTTCA TTGGGAGCTA
CTCCTTCACA GATCGCAGCA ACATCCCGGA TAGGTACTAT GATGGCAGAA AGATCCTATT ATGTCCCTTC CACTCTTGAC
GGGAATGAAA ATGCTGGTTC ATCAGCTTAC TCAAAGAAGT ACCACAGCTC ACCAGACATA TCTGCACTGA TTGCTGCAAG
CAGGAGTGCT CTGTTGAATG AATCAAAGTT GGGTGGTGGT ACCATTGGAT CCCAGTCGTA CCTTAGCAGG CTTGCATCGG
AAAGATCTCA GTATACAAAC TCGGTGGCCA GGCCTGCAGC TCCCTTGGCG TTTGATGAGC TCTCTCCACC TAAGCTCCCA
GGGGATATCT TCTCAATGCA ACAAAGCCCA AACCCAAGTG CAAGATCCCT TTGGGCTAAG CAACCTTTTG AGCAGCTGTT
TGGTGTGTCG AGTGCGGAGC TCACTAAAAG CGAGTTCAAC CCTGCAGGCA GATCGGGTGG CATGACCAAG GATGATTTCT
CTTACAAGGA GTCTGAGGCG AAGCTTCTTC AGTCTCTTAG ATTCTGCATC TCGAAGCTCC TGAAGCTAGA AGGATCAGGG
TGGCTGTTCA AGCAAAATGG TGGCAGCGAC GAAGATCTGA TTGATCAAGT TGCTGCGGTA GAGAAGCTAT TGCAACAAGG
AACCAGTGAC AACCAACTGC TGCTTGGTGA TACTCAGCAA CCACCATGTG ATAAGGCAGA CATCCAGTAC ATGCGCGTAC
TGCCTAACTG CGGAGACGAC TGCATCTGGC GCGCCTCCCT CGTTGTCAGC TTCGGTGTCT GGTGCATCCG CCGGGTGCTA
GACCTGTCTC TGGTGGAAAG CAGGCCAGAA CTTTGGGGCA AGTATACCTA TGTTCTCAAC CGTCTTCAGG TGAGCTATTT
CAGTCCTGAA CTAGTCTGAA TTTGAGTGTT GTTTTTCAGT GCCCAAGACT TGACTGCAAA CCTGAAACTG CTCATTTTCA
ACGTACAAGA CTAACTCTGT CAATCATTTT TTTCGCTCAA ATGTAATGCA GGGCATCCTG GATCCTGCAT TCTCCAAGCC
TCGGAGTGCT CTCAGCGCGT GTGCGTGCCT TCACAGAGAT ATCCGGGTGC TCAACAGCCT GCGCCACAGT AGCCTGGTAG
CAACAAACTC CATTCCAAGG CAAATCCGAG GTTCCTTCAC CACCGCATCT GTGGTCCTGG AGATGATCAA GGATGTGGAG
ACCGCAGTCT CAGGGCGCAA GGGCAGGAGT GGCACCGCAG CTGGGGATGT CGCCTTCCCC AAGGGGAAGG AGAACCTGGC
CTCCGTGCTG AAGCGATACA AGCGGAGGCT CTCGAGCAAG GGACAACAAT AATAAGGCAT CTGGGCAGCG TGATCCTGTC
GCGTTTTAGG GGGACTTTGA CCATTGTTCT TCAAGGATGG CAGCCAGCCA TGGTGGCTTG CCCTCCCTGA GCCCTGGATT
TTTTCGTTGC ACAACGTTTG CAGGGACCTG AGGAATTGGC CAACACTTCT GGTCCCTTCC ATCATATTTC GTTTTTTTTT
GTTTCTTTCT TGTTTTTTTT TTTTTTTTTG CATGTGATGT GTTGTATAAT GGTAACTGTT CATGTGCCAG AAGAACAACC
ACCAAAATGT ACAACAGATG TAGTCAGCTG ATGCACCATT GTAAAGTTTA GTCTCTGCAT TTTAACCTTT TTTTTGGGGG
TCATTGACAA ACTGAATGAA TGCCCTGTGT AATCTCTCTT CAGAGAGGAT GCCAAGACTG AGAAAAAGCT TTTGCCAGAT
TTCC

Locus: Os07g0155600

Loading...

Locus: Os07g0155600

Loading...