Os07t0158500-00

Locus

Os07g0158500

Description

Similar to HAP2 subunit of HAP complex.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP2J

CGSNL Gene Name

HAP2 SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP2J, NF-YA, CBF-B, NF-YA5, OsNF-YA5, NFYA5

Oryzabase Gene Name Synonym(s)

NUCLEAR FACTOR-Y subunit A5, NUCLEAR FACTOR-Y subunit NF-YA5, NF-YA transcription factor 5, NF-YA subunit 5, NF-YA family 5

Transcript Evidence

FP101566 (DDBJ)

Protein Evidence

B0S4T5 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Cellular Component: CCAAT-binding factor complex (GO:0016602)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Functional domain (InterPro)

CCAAT-binding transcription factor, subunit B (IPR001289)

CCAAT-binding factor, conserved site (IPR018362)

Expression Databases

TENOR (Os07t0158500-00)

Others

Oryzabase (8482)

Transcript

1298 bp

>Os07t0158500-00 Similar to HAP2 subunit of HAP complex.
TTTGCTTTCTTGGGCTGTGGTTTCAAACTTCCAAGCTTTTCTTCCCTCTCATGGAAGAAT
TTTCCGTTCTTGCAGGCAGCTCTGAGCTTCCAAGATCACGGCCATGGGCTTCAGGCGATC
ACCGGCCGTGGCGGCAATGGCGGCGCCGCCGCTCACGCATTGCCATGGTGGGCTGGAGCC
GGAGCCGGAGCTGGATCCCAAACACTGCTTGGAACAGGAGGAGGAGAAGAATCATTCTGC
CAATTAAGCAACACAATCATGGAGGACACCCGAATCCTGCAAAACCACCACCACCAGATC
CTCGCCGCCGGCCGGCAGCTGCAGCAGCGCCACCACTTCCCGGCAATGCCGCCGGAGCGA
CACCACCACCCTCCTCCTCCAGCTCCTGGAAGCCCTGCCATGAAGTTCCCAATCATCTCA
GGTGACTCTGATCTTGGCAAAGATCTGAAGTTCCATGAGTCCTCCGCGCCGACCATCGCC
GCGTACTCGCCATTGCAGGAGTACCAAGGACACTTTGAGCTAGCCCTTGGCCACTCCATG
GTTTGCACCAACTTCTGCAACTCTGAACAAAGCTATGGTGTTTACTCCCCCTATGGAGCT
CAAACCATGGCTGGGAGGATGCTGCTGCCGCCGGCGATCGCCACCGACGTGGGTCCGATC
TACGTCAACGCGAAGCAGTTCAACGGCATCATCCGGCGGCGGCTGGCGCGCGCCAAGGCG
GAGCGGGAGCACCGGGTTTCCCGGAGCCGGAAGCCGTACCTCCACGAGTCGCGCCACCGC
CACGCCATGCGCCGCGCGCGGGGCAGCGGCGGCCGCTTCCTCAACACCAAGAACGCCTCC
TCCGCCGCCGCCGCGGCCGCCGACGCGGCGCCGGTGAGCTCCGGTGGCGGCGACCACGGG
GCGAGCAACAAGAGCTCGTCGGCGTCGGAGGCGACGCGCGTGTACGACGACGACGACGAC
ATGGGCGCGGGCGGCGGCGGCGACGGCGGCGACTTCCACCACGCGATGGGTCACCTCCGC
TCGCCGGCGTTCTTCCCGTCGCTGGCCGCGATGATGGACGGCGGCGGCGGCGGCGGCGAG
GGGAAGTGGGCGACCGCGACGCCTCACCATGGCTGCCGCGTCGACCTCCTCAAGGTGTGA
CCGCCGCCGCTGGCCGTCGCCGGCGAACCTCGCCGGCGCCGGTGGCAATTCATCCTTGGC
TGTAGTAGTAGTAGTAGTAGTAGACTAGTAGTGTATGCGCAATGGAAATCAATTTCATGC
AACTGATGCAAACTGCTTCTCAGTTGCTCATGTAAAAA

CDS

1140 bp

>Os07t0158500-00 Similar to HAP2 subunit of HAP complex.
TTTGCTTTCTTGGGCTGTGGTTTCAAACTTCCAAGCTTTTCTTCCCTCTCATGGAAGAAT
TTTCCGTTCTTGCAGGCAGCTCTGAGCTTCCAAGATCACGGCCATGGGCTTCAGGCGATC
ACCGGCCGTGGCGGCAATGGCGGCGCCGCCGCTCACGCATTGCCATGGTGGGCTGGAGCC
GGAGCCGGAGCTGGATCCCAAACACTGCTTGGAACAGGAGGAGGAGAAGAATCATTCTGC
CAATTAAGCAACACAATCATGGAGGACACCCGAATCCTGCAAAACCACCACCACCAGATC
CTCGCCGCCGGCCGGCAGCTGCAGCAGCGCCACCACTTCCCGGCAATGCCGCCGGAGCGA
CACCACCACCCTCCTCCTCCAGCTCCTGGAAGCCCTGCCATGAAGTTCCCAATCATCTCA
GGTGACTCTGATCTTGGCAAAGATCTGAAGTTCCATGAGTCCTCCGCGCCGACCATCGCC
GCGTACTCGCCATTGCAGGAGTACCAAGGACACTTTGAGCTAGCCCTTGGCCACTCCATG
GTTTGCACCAACTTCTGCAACTCTGAACAAAGCTATGGTGTTTACTCCCCCTATGGAGCT
CAAACCATGGCTGGGAGGATGCTGCTGCCGCCGGCGATCGCCACCGACGTGGGTCCGATC
TACGTCAACGCGAAGCAGTTCAACGGCATCATCCGGCGGCGGCTGGCGCGCGCCAAGGCG
GAGCGGGAGCACCGGGTTTCCCGGAGCCGGAAGCCGTACCTCCACGAGTCGCGCCACCGC
CACGCCATGCGCCGCGCGCGGGGCAGCGGCGGCCGCTTCCTCAACACCAAGAACGCCTCC
TCCGCCGCCGCCGCGGCCGCCGACGCGGCGCCGGTGAGCTCCGGTGGCGGCGACCACGGG
GCGAGCAACAAGAGCTCGTCGGCGTCGGAGGCGACGCGCGTGTACGACGACGACGACGAC
ATGGGCGCGGGCGGCGGCGGCGACGGCGGCGACTTCCACCACGCGATGGGTCACCTCCGC
TCGCCGGCGTTCTTCCCGTCGCTGGCCGCGATGATGGACGGCGGCGGCGGCGGCGGCGAG
GGGAAGTGGGCGACCGCGACGCCTCACCATGGCTGCCGCGTCGACCTCCTCAAGGTGTGA

Protein

380 aa

>Os07t0158500-00 Similar to HAP2 subunit of HAP complex.
FAFLGCGFKLPSFSSLSWKNFPFLQAALSFQDHGHGLQAITGRGGNGGAAAHALPWWAGA
GAGAGSQTLLGTGGGEESFCQLSNTIMEDTRILQNHHHQILAAGRQLQQRHHFPAMPPER
HHHPPPPAPGSPAMKFPIISGDSDLGKDLKFHESSAPTIAAYSPLQEYQGHFELALGHSM
VCTNFCNSEQSYGVYSPYGAQTMAGRMLLPPAIATDVGPIYVNAKQFNGIIRRRLARAKA
EREHRVSRSRKPYLHESRHRHAMRRARGSGGRFLNTKNASSAAAAAADAAPVSSGGGDHG
ASNKSSSASEATRVYDDDDDMGAGGGGDGGDFHHAMGHLRSPAFFPSLAAMMDGGGGGGE
GKWATATPHHGCRVDLLKV*

CDS

chr07:3130094..3130514 (- strand) : 421 bp

chr07:3128920..3129038 (- strand) : 119 bp

chr07:3128751..3128819 (- strand) : 69 bp

chr07:3128432..3128575 (- strand) : 144 bp

chr07:3127907..3128293 (- strand) : 387 bp

3'UTR

chr07:3127749..3127906 (- strand) : 158 bp

FASTA

>Os07t0158500-00 class=Sequence position=chr07:3127749..3130514 (- strand)
TTTGCTTTCT TGGGCTGTGG TTTCAAACTT CCAAGCTTTT CTTCCCTCTC ATGGAAGAAT TTTCCGTTCT TGCAGGCAGC
TCTGAGCTTC CAAGATCACG GCCATGGGCT TCAGGCGATC ACCGGCCGTG GCGGCAATGG CGGCGCCGCC GCTCACGCAT
TGCCATGGTG GGCTGGAGCC GGAGCCGGAG CTGGATCCCA AACACTGCTT GGAACAGGAG GAGGAGAAGA ATCATTCTGC
CAATTAAGCA ACACAATCAT GGAGGACACC CGAATCCTGC AAAACCACCA CCACCAGATC CTCGCCGCCG GCCGGCAGCT
GCAGCAGCGC CACCACTTCC CGGCAATGCC GCCGGAGCGA CACCACCACC CTCCTCCTCC AGCTCCTGGA AGCCCTGCCA
TGAAGTTCCC AATCATCTCA GGTGAGTCCC AAGAACTTGT CCAAGATTTG TAGTAAGATG ATCATTGGAG GTGTGTCTCG
TTCATGGCGC ATTCACGCCG TCGCGGTGGC GCCGCTGTCC TCCCATGGTG GAGATGGTGT ACCGGCCGGC CATTCCGGGT
GTTGGCCGCC GGCCATTTCG GTTAATTACT GCGGTGCAGT GAAGAAAAGA TTGTAGATAT GATGCTGTGG TCCTGAAAAC
TTTCATGGTC CAAGTCCTAG GAAACTTTAA ATGATGATGA TTTTGGGGTC ACTGATTCTG TGAAGGAGGT GAGGTTGTTG
TTGCCACAGT TATTAAGAGG TGTTTCTGCT CCTAATCATC TTTTTGTTTC TTTTCAAGAG TAAGCAAGTA GTACTGGGCA
CATAGGAGAT TATTTACTGT CGAGTAGGAA AGCTGCCCAA TGTCATGCAG CTTTACAACT GAAGAAAACT GAAAAAGAAA
AAGGAGAGAT GTTACCACTG GAAATCTGGT AGTACCAGCA CACAGAAAGG GTGGGCCTGG ATGAACTGAG TTACAAAACT
TGGGAAAAAG AAGTGTTTTA TTTTAAACTA TGTTTTGAAG GGGGTACAGA TTAGAACATT ATTTTAGTGT TAATTAATTT
GTTTTGTGGA AATCTATGTA CTTGTTGGAA TGTTCATTAC TGGCAGATAG TATGGCCATA GTTTTGCAAG AATGGAATCA
GGCTCCCCTC TAAAGGCTTT GGACTGAACC AGTGCATTTT ATTCCCTTTT ATAAAAGTGG AACTGAAAGT CTTTTGGGAG
ACTGAACAAG GGAAAAAGCT TTAGAGCAAA TGACATCACT CTTATCAGAA AAGGATCTAA TGCTTCAAAT GTTTTAATAG
GCAGCACTAC TCTCTTCTGT ATTCTAGATG AGATTCCAAA AACATTCTTA ATTGTTATTC CCTGGTTGGA ATCTTCCCTG
CCCACTAATT CCCCCAGCAG AACATAGTCA GACAAGATAC TTTGATAAAA ATAAAAAAAT ATATTGTCAA GTACTAAGAA
ATATCCATGA TGACAAAATA CCTCTGTGGT TTTCAGGTGA CTCTGATCTT GGCAAAGATC TGAAGTTCCA TGAGTCCTCC
GCGCCGACCA TCGCCGCGTA CTCGCCATTG CAGGAGTACC AAGGACACTT TGAGCTAGCC CTTGGCCACT CCATGGTGAG
AATTCTCTTA CCCAATTCAA GATTTACTCC AGAAACTGAA TCTCAAAAAC ATCTTTGGTT GAACCAGCTA ACTGTTTGTT
TCTGCAACTC TGAAGGTTTG CACCAACTTC TGCAACTCTG AACAAAGCTA TGGTGTTTAC TCCCCCTATG GAGCTCAAAC
CATGGTATAT ATGTTCTTCA GTTCTTGTCT TCTTGATCTC TGAACATCTC TGTCCAAATC CATGTGTAAA CTTCAGTTCA
GATTCAGCAT CAGTATGCCA TGCCATTTTG ACAAGAATCT GAAGAAGTTT CAGATGCTTA CTGTGAATAT TTTCTCTGAA
TGTTTTGTGT GCTTCAAAGG CTGGGAGGAT GCTGCTGCCG CCGGCGATCG CCACCGACGT GGGTCCGATC TACGTCAACG
CGAAGCAGTT CAACGGCATC ATCCGGCGGC GGCTGGCGCG CGCCAAGGCG GAGCGGGAGC ACCGGGTTTC CCGGAGCCGG
AAGGTAAGAC GGCGGCGACG GCGACGGCGG CGGCGAGTGC TCGTCGTCGT CTCCTTCCCT TGTCAATTCG CCGGCGAACT
GGCAGTGACA GTGACTGACT CGTCTTCTTC TTCTTCTTCT TCTTCTTCGG CGACGGCGCA GCCGTACCTC CACGAGTCGC
GCCACCGCCA CGCCATGCGC CGCGCGCGGG GCAGCGGCGG CCGCTTCCTC AACACCAAGA ACGCCTCCTC CGCCGCCGCC
GCGGCCGCCG ACGCGGCGCC GGTGAGCTCC GGTGGCGGCG ACCACGGGGC GAGCAACAAG AGCTCGTCGG CGTCGGAGGC
GACGCGCGTG TACGACGACG ACGACGACAT GGGCGCGGGC GGCGGCGGCG ACGGCGGCGA CTTCCACCAC GCGATGGGTC
ACCTCCGCTC GCCGGCGTTC TTCCCGTCGC TGGCCGCGAT GATGGACGGC GGCGGCGGCG GCGGCGAGGG GAAGTGGGCG
ACCGCGACGC CTCACCATGG CTGCCGCGTC GACCTCCTCA AGGTGTGACC GCCGCCGCTG GCCGTCGCCG GCGAACCTCG
CCGGCGCCGG TGGCAATTCA TCCTTGGCTG TAGTAGTAGT AGTAGTAGTA GACTAGTAGT GTATGCGCAA TGGAAATCAA
TTTCATGCAA CTGATGCAAA CTGCTTCTCA GTTGCTCATG TAAAAA

Locus: Os07g0158500

Loading...

Locus: Os07g0158500

Loading...