Os07t0160100-01

Locus

Os07g0160100

Description

Similar to cDNA clone:J023038F18, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

YAB1

CGSNL Gene Name

YABBY1

Oryzabase Gene Symbol Synonym(s)

OsYAB1, FIL1, osFIL1

Oryzabase Gene Name Synonym(s)

YABBY1 gene, YABBY 1, OsYABBY1, Os YABBY1, FILAMENTOUS FLOWER 1, Protein YABBY 1, Protein FILAMENTOUS FLOWER 1, FIL homolog 1

Transcript Evidence

AK120952 (DDBJ, Best hit)

Protein Evidence

D3U2G4 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

YABBY protein (IPR006780)

Full-length cDNA

J023038N03 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0160100-01)

RiceXPro (AK120952)

Others

Oryzabase (6310)

KEGG (Os07t0160100-01)

Transcript

4832 bp

>Os07t0160100-01 Similar to cDNA clone:J023038F18, full insert sequence.
GTATAtactacttccgtcccaaaataagtgcagtcgtggatatctgtgtctaatgtttga
ctgtctgtcttatttaaaaaaattatgaaaaaattaataaaattagtcacaaaaagtatt
attcatgttttatcatctaataacaataaaaatactaatcataaatttttttaataagac
gaatggtcaaacgttggacatgaaagtgcaaaactGCTGATCGCACCCAAAGCTGCTAGC
TAGTAGTACCTCCACTTACCAGAAACCGGGTTAGCCCTGACGGCTAAAAACCGTCAAGAA
TAAACGAATGGAAGGGGATGCTTGATCCTGTAGCCCCATCTCAAGTGACGTGCAATATAC
TGTACATAAATGTGTACATGAACTTGAATTGTTGTATTATAGTCTATATACCACTATATA
CATTGATAAGACAAGAACAAAGGGTTTTGGAACTTTGTTCTTCATCGAGGGAATTAATAG
CATTAATACAAAAATCGTACATTGTTTTGTTTGACAGATTAACAGTATAATGCAATGTTA
TATTTAATTCATGTTTTTCTTGACTCCGTAAAGATAGTCAATAAAGTTGTGCATGCATGG
CTTTCTTGTCAATAAATGTGATTCTTGCACATTGTGCATACCAGTCACACATTTTCCATT
TTGTTGATGTTGTTAGGCCCAATGTTATTTGGTATGAAAATGATGCCATACTGCCACACA
CAAACGAATGCGAGATGACAACCAACGTTAAACAAAAAAAAACAGAACCTATCTGCTGAT
CAAAGACAAACCCTGCAAGCCAGTAACGGTAATGCATGCAGTAGTACTGCACTAAACAGC
AGAAGTCCTAAATAATTAATTCACCATGGAATATTAAGCCCCCTGGCAACGTAGACTCTT
CTCCTACCACTCATTCTCCCAAATAAGCTACCCACTCCGTCCAACGATATAAGCATTTCT
AGATTGTTAAGtactccctccattccaaattgatatacatatagtttttttgaggttatt
cctaaatgatctacatatttgtgttcattcattaggtctattcgttatttgtgcattgga
gtaaatggacattgatgcatgcatccatgcacacaagtatttataacccacatgcaatat
cttgatttgttattggctaggagatagtggggatggtgcatgcatctagcttgttgctag
agtaaatatagtatgagagagttattagcttttcttggtcttggtgtacatatgaaatat
gtagatcaatttggaatggagggagtaAATGTGAAGGTTAAGGAGAAAAGACTTTAGTCT
CTCTCGTTTAATGAGAGATTGATGGTTGGGGATGGAAGGGTGATTGAGAGTAAGAATTGG
AGGTGATTGGTGTAACAAGTACACAAGTGTATGAATGCTATTATTAATTCTTGGATAAAA
TTCAAATGCTTATATTGTTGGACGGACGGAGTACTAGCTATATAGCTAGTCACACCAGCA
TTTGCTAATTGGCTGCTCATCTGCTGTACCCACATTTCATTTGGCCTTGATCTTTCCAAC
CTCTCCTTGCACTCAGCTTGCAGCTTAGCTAGCTGCACACACTGTCCTCCCACAAGACAC
CCCACCAAACACCTTTTCTTCCTCCCTTTCTTGTGTGTGCCCCCACTCAGATCAGCCAGC
AGCTGGTAGTACCCTCTCTAGCTTATTGCAGGGCCATATCCTCTGCTAGCTTAGCTTCTC
TCACAAACCCCTTAATTCCATCTCATAGACAGCCAAAAGGGTCAAGAGGAAATTGGGTTT
GTGCTCTCCCCAAAATCCTCCATATATAGTGCACAGGAGGCATCATTCTGTTCATACATA
TCTCTCCCTTGCTTGCTTTGCTCCTGGATATATAGCTAGCTTCTTTCTTTCTTCCTCTCT
CCCTGTGTGGCACGCGCCTCCAATCGATCTCTTCGGTGAGTAGACGCATCGAGATCGGGG
GGAAATGTCGGTCCAGTTTACATCGGAGCATGTTTGCTATGTCAACTGCAACTATTGCAA
CACTATCCTTGTGGTATCGTCTTCCTCCCTCATCTCTTTCTCTCTCTAGCTCTCTCTCTC
TCTCTCATATCTTGTGTATTTCTGTTCTAATTTGAGGTGTTTGCCGGATCTATATGGGGA
GTTCAATTTTTTTGTATATTTTTTTGAAGGGGCTAATGCGTGCATGCTGTAGTCCATGCA
TAGAGGTAGCCTAAGCTAGGGGAAAATAAGCACCCTAATCAAGTATGCTAGCTACTTGTT
TACTAAACTAATTGCACTTTGTTTTGTCCTGGATAAGTTTGTAATTTTATATTTCTGGAG
AGTTCTCCAGTACATCGAAATCCAGCAATCCGGTCTTTTTGCATAAACTTCCATGTACAT
GGTAACAGAAATGCACAGATTTTCTTTATGGCAAACATAAAATCATATAAATAGAAGGAT
ATTGCAAACATACTTTGTACTATTTCTTTTCATCTTCTCCAACTTTTCAAGAAAAAAAAA
TCCATATCTTCCACCCAAGGGTGTCATTTTTGTATCTCCTTGAAACAAGACTGTTTCTCT
CTGACTTGATCCACCTTGTACGGTTTTAATTTATTTTTACAGAAGGGATAAACTCTTCTT
GGTTTTGGATGAGAACCAACATATTTGTATATATCCTATAGCGGTGCATTATCCAGATCC
AACACTATTTGATTATATTCTTTCGCTCATCAGGCAAAATATCTTGTACAAAATGGTAAT
TTTCCTTGGAAAGAATGCTTGATTTGCTCATAGAGAAAAAAAAAAGTATTGTCCCCGACA
TACATAGTTTTTCGACGCATGGGGTCATACACATTTTTGGAAGGAACATGTACATAAGAT
AATATTATCTGAGAGCTTTCTCATGTATGGATCTACTATACTACCACAAAAAGAAAGAAA
TAATTTCAGGTCAAATTAAACTTTTAGATGCGTGCAGGTGATTAAAGCTAGCATCTTTAA
CCATTAATTATTGCCTCTCTAGCTTTAGCTAGCTGCTCCATGCGATAATACCCCAGTGTC
TGTACTGTGCTGCACACTTGGAGCTATTCCTCTGATTATTGGCTGTGCCCTGAGTGTGCC
CACCTCTCCAAAACCGAAATTTTTTATGAATAAACAAATTTTAATTAACAAAAAAGGCTT
TAAGCTGCTGCCTGTTGCTACCACATCCTGCAGCTTTGTCTCTCATTCTGCACATGTGCA
GAAAGAAGTGGATCTGCCTGTCATGTCATTTTCCTCTTTGTTGATGTTTGCGCAGGTGGG
TCTCTTCTACATACTCTCTCTAGCTAGCTAGTAGTAGTAGCTATATTGTGTGTGTGTGAG
TATGCAATATATATGCATGCGTCTCTTAGTATGTGTTGTGCTGAAAGAGAGGAGAGTGTG
ACATGAACTTTTAACTGTAAAAGAAGTGTGACATGAACTTTTAACTGTAAAGATGCCTCC
TCTTTTTTCATGCTTTTTTTTTGGAAAGGATGATTGTACTGTTCACACGACCAAATCTAA
CTTACCTAAGTATAGATCTCAGTCATCTGCACATAGATTTCTCTATCTCAATCTCAAGAT
CTGTCTCTCTGCTGTGTCTCTCTCTTCCTGTTTGTTTGTGTGTGTGTGTCTGACTGATGA
GATGAATCTAGGGAGATATTCTTCTTTAGACCTGATTGAGATGTCATGTCTCTGCCTCCT
GGAGGCCTTGAGTGTGTGAGATGCATCATGCATTGCATGGTAGTAAGAGAAAACATGCAT
ATATGGCTCAAGCTTCTCCAGGCAAAGAGCTAGCTAAGCTCTCAAAAGGGAGACACACTT
GGGAAAAGGTGTTATTTGTGCATGATGGCCAAATAGGACTCAAAAGACGATATGGATATG
AGACATGGTGCAACTTTTGACATTCCTAGCTACTAGCTAGCTACTTTGTCATCACACATA
TATATTGACTACATACACATATATATTGACTACATACACACATACACATATATATTGTGA
AACGGTACGTAGCCTAGTGGTTGCAGTGACCTGAGTAACACCCCAAGGTTCTGAGTTcaa
atatccatagaagtgaattttagattgggttatattatggatggctaagttctctgtgtg
ataggctaagttcctaatttaaaacgggttatttgtgcttgataggctaagtttttatcc
aattggatatagaggccgggtaaaaaaatacacttctctaaaaaCACACACACATGCATT
GGCATTTGACAATTAATATATATGGATATATACTTCAATTAATCTTGTAGCTGCAAGGCT
ACTATTTTTTTTCCAGCAGCATGGTCATCTACTCACCTCTTATTTGCAGTGCATGACTGA
ACACTGTTGCAGAGAACACATTGAATTATTTGAAGAGAGACCAGACGGTAGCATACGTTG
ATATACATGTTCAGGCCAATGCTGATACATATAGCTAGCAAGCTAGCTAGCATAGCATTT
TAGCATTATTTGCTTGGATTCTTGTGGATCGATCTGCGATAAATAATTTTATGAACAGTT
ATATCTTATACCACTATTTAAGAATCCAATGAATTTGGACGAAGGGACTAGGGAGTCAAT
TAATTAGGACCAGGAGGTAAACAATAATACTGTGTGCTTGTGTGGTAACTCTACCAGACT
TATTAATTGGAGCTACATATTCCATGTATATATATATGTCATGAAATCCTATTTTTTTCT
GTTTTACGTTTCTGATAGAATTACCCCTATATATTTTTATTAATAAGTTTGTTATGCATA
TAATAAATCACAGTGTTCTGAGAGAGGAAACG

CDS

105 bp

>Os07t0160100-01 Similar to cDNA clone:J023038F18, full insert sequence.
ATGTCGGTCCAGTTTACATCGGAGCATGTTTGCTATGTCAACTGCAACTATTGCAACACT
ATCCTTGTGGTATCGTCTTCCTCCCTCATCTCTTTCTCTCTCTAG

Protein

34 aa

>Os07t0160100-01 Similar to cDNA clone:J023038F18, full insert sequence.
MSVQFTSEHVCYVNCNYCNTILVVSSSSLISFSL*

5'UTR

chr07:3219923..3221906 (+ strand) : 1984 bp

CDS

chr07:3221907..3222011 (+ strand) : 105 bp

3'UTR

chr07:3222012..3224754 (+ strand) : 2743 bp

FASTA

>Os07t0160100-01 class=Sequence position=chr07:3219923..3224754 (+ strand)
GTATAtacta cttccgtccc aaaataagtg cagtcgtgga tatctgtgtc taatgtttga ctgtctgtct tatttaaaaa
aattatgaaa aaattaataa aattagtcac aaaaagtatt attcatgttt tatcatctaa taacaataaa aatactaatc
ataaattttt ttaataagac gaatggtcaa acgttggaca tgaaagtgca aaactGCTGA TCGCACCCAA AGCTGCTAGC
TAGTAGTACC TCCACTTACC AGAAACCGGG TTAGCCCTGA CGGCTAAAAA CCGTCAAGAA TAAACGAATG GAAGGGGATG
CTTGATCCTG TAGCCCCATC TCAAGTGACG TGCAATATAC TGTACATAAA TGTGTACATG AACTTGAATT GTTGTATTAT
AGTCTATATA CCACTATATA CATTGATAAG ACAAGAACAA AGGGTTTTGG AACTTTGTTC TTCATCGAGG GAATTAATAG
CATTAATACA AAAATCGTAC ATTGTTTTGT TTGACAGATT AACAGTATAA TGCAATGTTA TATTTAATTC ATGTTTTTCT
TGACTCCGTA AAGATAGTCA ATAAAGTTGT GCATGCATGG CTTTCTTGTC AATAAATGTG ATTCTTGCAC ATTGTGCATA
CCAGTCACAC ATTTTCCATT TTGTTGATGT TGTTAGGCCC AATGTTATTT GGTATGAAAA TGATGCCATA CTGCCACACA
CAAACGAATG CGAGATGACA ACCAACGTTA AACAAAAAAA AACAGAACCT ATCTGCTGAT CAAAGACAAA CCCTGCAAGC
CAGTAACGGT AATGCATGCA GTAGTACTGC ACTAAACAGC AGAAGTCCTA AATAATTAAT TCACCATGGA ATATTAAGCC
CCCTGGCAAC GTAGACTCTT CTCCTACCAC TCATTCTCCC AAATAAGCTA CCCACTCCGT CCAACGATAT AAGCATTTCT
AGATTGTTAA Gtactccctc cattccaaat tgatatacat atagtttttt tgaggttatt cctaaatgat ctacatattt
gtgttcattc attaggtcta ttcgttattt gtgcattgga gtaaatggac attgatgcat gcatccatgc acacaagtat
ttataaccca catgcaatat cttgatttgt tattggctag gagatagtgg ggatggtgca tgcatctagc ttgttgctag
agtaaatata gtatgagaga gttattagct tttcttggtc ttggtgtaca tatgaaatat gtagatcaat ttggaatgga
gggagtaAAT GTGAAGGTTA AGGAGAAAAG ACTTTAGTCT CTCTCGTTTA ATGAGAGATT GATGGTTGGG GATGGAAGGG
TGATTGAGAG TAAGAATTGG AGGTGATTGG TGTAACAAGT ACACAAGTGT ATGAATGCTA TTATTAATTC TTGGATAAAA
TTCAAATGCT TATATTGTTG GACGGACGGA GTACTAGCTA TATAGCTAGT CACACCAGCA TTTGCTAATT GGCTGCTCAT
CTGCTGTACC CACATTTCAT TTGGCCTTGA TCTTTCCAAC CTCTCCTTGC ACTCAGCTTG CAGCTTAGCT AGCTGCACAC
ACTGTCCTCC CACAAGACAC CCCACCAAAC ACCTTTTCTT CCTCCCTTTC TTGTGTGTGC CCCCACTCAG ATCAGCCAGC
AGCTGGTAGT ACCCTCTCTA GCTTATTGCA GGGCCATATC CTCTGCTAGC TTAGCTTCTC TCACAAACCC CTTAATTCCA
TCTCATAGAC AGCCAAAAGG GTCAAGAGGA AATTGGGTTT GTGCTCTCCC CAAAATCCTC CATATATAGT GCACAGGAGG
CATCATTCTG TTCATACATA TCTCTCCCTT GCTTGCTTTG CTCCTGGATA TATAGCTAGC TTCTTTCTTT CTTCCTCTCT
CCCTGTGTGG CACGCGCCTC CAATCGATCT CTTCGGTGAG TAGACGCATC GAGATCGGGG GGAAATGTCG GTCCAGTTTA
CATCGGAGCA TGTTTGCTAT GTCAACTGCA ACTATTGCAA CACTATCCTT GTGGTATCGT CTTCCTCCCT CATCTCTTTC
TCTCTCTAGC TCTCTCTCTC TCTCTCATAT CTTGTGTATT TCTGTTCTAA TTTGAGGTGT TTGCCGGATC TATATGGGGA
GTTCAATTTT TTTGTATATT TTTTTGAAGG GGCTAATGCG TGCATGCTGT AGTCCATGCA TAGAGGTAGC CTAAGCTAGG
GGAAAATAAG CACCCTAATC AAGTATGCTA GCTACTTGTT TACTAAACTA ATTGCACTTT GTTTTGTCCT GGATAAGTTT
GTAATTTTAT ATTTCTGGAG AGTTCTCCAG TACATCGAAA TCCAGCAATC CGGTCTTTTT GCATAAACTT CCATGTACAT
GGTAACAGAA ATGCACAGAT TTTCTTTATG GCAAACATAA AATCATATAA ATAGAAGGAT ATTGCAAACA TACTTTGTAC
TATTTCTTTT CATCTTCTCC AACTTTTCAA GAAAAAAAAA TCCATATCTT CCACCCAAGG GTGTCATTTT TGTATCTCCT
TGAAACAAGA CTGTTTCTCT CTGACTTGAT CCACCTTGTA CGGTTTTAAT TTATTTTTAC AGAAGGGATA AACTCTTCTT
GGTTTTGGAT GAGAACCAAC ATATTTGTAT ATATCCTATA GCGGTGCATT ATCCAGATCC AACACTATTT GATTATATTC
TTTCGCTCAT CAGGCAAAAT ATCTTGTACA AAATGGTAAT TTTCCTTGGA AAGAATGCTT GATTTGCTCA TAGAGAAAAA
AAAAAGTATT GTCCCCGACA TACATAGTTT TTCGACGCAT GGGGTCATAC ACATTTTTGG AAGGAACATG TACATAAGAT
AATATTATCT GAGAGCTTTC TCATGTATGG ATCTACTATA CTACCACAAA AAGAAAGAAA TAATTTCAGG TCAAATTAAA
CTTTTAGATG CGTGCAGGTG ATTAAAGCTA GCATCTTTAA CCATTAATTA TTGCCTCTCT AGCTTTAGCT AGCTGCTCCA
TGCGATAATA CCCCAGTGTC TGTACTGTGC TGCACACTTG GAGCTATTCC TCTGATTATT GGCTGTGCCC TGAGTGTGCC
CACCTCTCCA AAACCGAAAT TTTTTATGAA TAAACAAATT TTAATTAACA AAAAAGGCTT TAAGCTGCTG CCTGTTGCTA
CCACATCCTG CAGCTTTGTC TCTCATTCTG CACATGTGCA GAAAGAAGTG GATCTGCCTG TCATGTCATT TTCCTCTTTG
TTGATGTTTG CGCAGGTGGG TCTCTTCTAC ATACTCTCTC TAGCTAGCTA GTAGTAGTAG CTATATTGTG TGTGTGTGAG
TATGCAATAT ATATGCATGC GTCTCTTAGT ATGTGTTGTG CTGAAAGAGA GGAGAGTGTG ACATGAACTT TTAACTGTAA
AAGAAGTGTG ACATGAACTT TTAACTGTAA AGATGCCTCC TCTTTTTTCA TGCTTTTTTT TTGGAAAGGA TGATTGTACT
GTTCACACGA CCAAATCTAA CTTACCTAAG TATAGATCTC AGTCATCTGC ACATAGATTT CTCTATCTCA ATCTCAAGAT
CTGTCTCTCT GCTGTGTCTC TCTCTTCCTG TTTGTTTGTG TGTGTGTGTC TGACTGATGA GATGAATCTA GGGAGATATT
CTTCTTTAGA CCTGATTGAG ATGTCATGTC TCTGCCTCCT GGAGGCCTTG AGTGTGTGAG ATGCATCATG CATTGCATGG
TAGTAAGAGA AAACATGCAT ATATGGCTCA AGCTTCTCCA GGCAAAGAGC TAGCTAAGCT CTCAAAAGGG AGACACACTT
GGGAAAAGGT GTTATTTGTG CATGATGGCC AAATAGGACT CAAAAGACGA TATGGATATG AGACATGGTG CAACTTTTGA
CATTCCTAGC TACTAGCTAG CTACTTTGTC ATCACACATA TATATTGACT ACATACACAT ATATATTGAC TACATACACA
CATACACATA TATATTGTGA AACGGTACGT AGCCTAGTGG TTGCAGTGAC CTGAGTAACA CCCCAAGGTT CTGAGTTcaa
atatccatag aagtgaattt tagattgggt tatattatgg atggctaagt tctctgtgtg ataggctaag ttcctaattt
aaaacgggtt atttgtgctt gataggctaa gtttttatcc aattggatat agaggccggg taaaaaaata cacttctcta
aaaaCACACA CACATGCATT GGCATTTGAC AATTAATATA TATGGATATA TACTTCAATT AATCTTGTAG CTGCAAGGCT
ACTATTTTTT TTCCAGCAGC ATGGTCATCT ACTCACCTCT TATTTGCAGT GCATGACTGA ACACTGTTGC AGAGAACACA
TTGAATTATT TGAAGAGAGA CCAGACGGTA GCATACGTTG ATATACATGT TCAGGCCAAT GCTGATACAT ATAGCTAGCA
AGCTAGCTAG CATAGCATTT TAGCATTATT TGCTTGGATT CTTGTGGATC GATCTGCGAT AAATAATTTT ATGAACAGTT
ATATCTTATA CCACTATTTA AGAATCCAAT GAATTTGGAC GAAGGGACTA GGGAGTCAAT TAATTAGGAC CAGGAGGTAA
ACAATAATAC TGTGTGCTTG TGTGGTAACT CTACCAGACT TATTAATTGG AGCTACATAT TCCATGTATA TATATATGTC
ATGAAATCCT ATTTTTTTCT GTTTTACGTT TCTGATAGAA TTACCCCTAT ATATTTTTAT TAATAAGTTT GTTATGCATA
TAATAAATCA CAGTGTTCTG AGAGAGGAAA CG

Locus: Os07g0160100

Loading...

Locus: Os07g0160100

Loading...