Os07t0160100-02

Locus

Os07g0160100

Description

YABBY family transcription factor, Stamen and carpel development, Feedback regulation of gibberellin biosynthesis

RAP-DB Gene Symbol Synonym(s)

YAB1, OsYAB1, FIL1, osFIL1

RAP-DB Gene Name Synonym(s)

YABBY1, YABBY1 gene, YABBY 1, OsYABBY1, , Os YABBY1, FILAMENTOUS FLOWER 1, Protein YABBY 1, Protein FILAMENTOUS FLOWER 1, FIL homolog 1

CGSNL Gene Symbol

YAB1

CGSNL Gene Name

YABBY1

Oryzabase Gene Symbol Synonym(s)

OsYAB1, FIL1, osFIL1

Oryzabase Gene Name Synonym(s)

YABBY1 gene, YABBY 1, OsYABBY1, Os YABBY1, FILAMENTOUS FLOWER 1, Protein YABBY 1, Protein FILAMENTOUS FLOWER 1, FIL homolog 1

Transcript Evidence

AF098752

AB274013

AK070045

Protein Evidence

Q7XIM7

Literature

PMID: 17369428

PMID: 17216490

PMID: 15604733

Note

Manual Curation

March 16, 2016

Gene Ontology (GO)

Biological Process: multicellular organismal development (GO:0007275)

Functional domain (InterPro)

YABBY protein (IPR006780)

High mobility group box domain (IPR009071)

Full-length cDNA

J023038F18 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0160100-02)

RiceXPro (AK070045)

Others

Oryzabase (6310)

KEGG (Os07t0160100-02)

Transcript

956 bp

>Os07t0160100-02 YABBY family transcription factor, Stamen and carpel development, Feedback regulation of gibberellin biosynthesis
ATACATATCTCTCCCTTGCTTGCTTTGCTCCTGGATATATAGCTAGCTTCTTTCTTTCTT
CCTCTCTCCCTGTGTGGCACGCGCCTCCAATCGATCTCTTCGGTGAGTAGACGCATCGAG
ATCGGGGGGAAATGTCGGTCCAGTTTACATCGGAGCATGTTTGCTATGTCAACTGCAACT
ATTGCAACACTATCCTTGTGGTGAATGTGCCAAACAATTGTTCCTACAACATTGTGACTG
TTAGATGTGGGCATTGCACAATGGTGCTCTCCATGGATCTTGCTCCTTTTCACCAAGCAC
GCACTGTTCAAGATCACCAGGTACAGAACAGAGGATTTCAAGGTAATAACTTTGGAAGCT
ATGACATAGCTTCCAGAAATCAGAGGACATCGACAGCCATGTACCCAATGCCAACCAGTC
AGCAGCAAGTGTCACCTATACGTCCCCCTGAGAAAAGACAGCGTGTCCCATCTGCATACA
ACAGATTCATCAAGGAGGAGATACAGAGGATTAAAACCAGCAATCCTGAGATTAGCCACA
GGGAGGCATTCAGTGCTGCTGCAAAGAACTGGGCTCATCTTCCCCGGCTCCATTTTGGCC
TCAGCGTCGCCGACGGCGGCGGCGGCGGCGGCAGCAACTAATCGCGGCGGCGCGGCCTGC
CGGCCGGCCACCGATCGCCGGCGTGCACGCCGGCGCGCGGCGGCGGCCGGTCGAGAATGC
GCGCGCAGGAGGGACGACGACGATATATTATTATCGCGTGTGCCCCTCTCTCTTCGCCGC
GTAATTAATTAATCAGTTAATTAATTACGTACGACCTACTGTGTTATGCTATCGATCCGT
GTTAATTAATTACCTACGTATCTTGATTAATTAGTCTCGTATTATACGTACTATTATACG
TACGTGCTGTGCTATGTACGTAGACAACAAAAAAAAATGTGCGTGATGAGTTCTAC

CDS

510 bp

>Os07t0160100-02 YABBY family transcription factor, Stamen and carpel development, Feedback regulation of gibberellin biosynthesis
ATGTCGGTCCAGTTTACATCGGAGCATGTTTGCTATGTCAACTGCAACTATTGCAACACT
ATCCTTGTGGTGAATGTGCCAAACAATTGTTCCTACAACATTGTGACTGTTAGATGTGGG
CATTGCACAATGGTGCTCTCCATGGATCTTGCTCCTTTTCACCAAGCACGCACTGTTCAA
GATCACCAGGTACAGAACAGAGGATTTCAAGGTAATAACTTTGGAAGCTATGACATAGCT
TCCAGAAATCAGAGGACATCGACAGCCATGTACCCAATGCCAACCAGTCAGCAGCAAGTG
TCACCTATACGTCCCCCTGAGAAAAGACAGCGTGTCCCATCTGCATACAACAGATTCATC
AAGGAGGAGATACAGAGGATTAAAACCAGCAATCCTGAGATTAGCCACAGGGAGGCATTC
AGTGCTGCTGCAAAGAACTGGGCTCATCTTCCCCGGCTCCATTTTGGCCTCAGCGTCGCC
GACGGCGGCGGCGGCGGCGGCAGCAACTAA

Protein

169 aa

>Os07t0160100-02 YABBY family transcription factor, Stamen and carpel development, Feedback regulation of gibberellin biosynthesis
MSVQFTSEHVCYVNCNYCNTILVVNVPNNCSYNIVTVRCGHCTMVLSMDLAPFHQARTVQ
DHQVQNRGFQGNNFGSYDIASRNQRTSTAMYPMPTSQQQVSPIRPPEKRQRVPSAYNRFI
KEEIQRIKTSNPEISHREAFSAAAKNWAHLPRLHFGLSVADGGGGGGSN*

5'UTR

chr07:3221776..3221906 (+ strand) : 131 bp

CDS

chr07:3221907..3221975 (+ strand) : 69 bp

chr07:3224909..3225028 (+ strand) : 120 bp

chr07:3225230..3225353 (+ strand) : 124 bp

chr07:3225826..3225874 (+ strand) : 49 bp

chr07:3227841..3227916 (+ strand) : 76 bp

chr07:3228671..3228742 (+ strand) : 72 bp

3'UTR

chr07:3228743..3229057 (+ strand) : 315 bp

FASTA

>Os07t0160100-02 class=Sequence position=chr07:3221776..3229057 (+ strand)
ATACATATCT CTCCCTTGCT TGCTTTGCTC CTGGATATAT AGCTAGCTTC TTTCTTTCTT CCTCTCTCCC TGTGTGGCAC
GCGCCTCCAA TCGATCTCTT CGGTGAGTAG ACGCATCGAG ATCGGGGGGA AATGTCGGTC CAGTTTACAT CGGAGCATGT
TTGCTATGTC AACTGCAACT ATTGCAACAC TATCCTTGTG GTATCGTCTT CCTCCCTCAT CTCTTTCTCT CTCTAGCTCT
CTCTCTCTCT CTCATATCTT GTGTATTTCT GTTCTAATTT GAGGTGTTTG CCGGATCTAT ATGGGGAGTT CAATTTTTTT
GTATATTTTT TTGAAGGGGC TAATGCGTGC ATGCTGTAGT CCATGCATAG AGGTAGCCTA AGCTAGGGGA AAATAAGCAC
CCTAATCAAG TATGCTAGCT ACTTGTTTAC TAAACTAATT GCACTTTGTT TTGTCCTGGA TAAGTTTGTA ATTTTATATT
TCTGGAGAGT TCTCCAGTAC ATCGAAATCC AGCAATCCGG TCTTTTTGCA TAAACTTCCA TGTACATGGT AACAGAAATG
CACAGATTTT CTTTATGGCA AACATAAAAT CATATAAATA GAAGGATATT GCAAACATAC TTTGTACTAT TTCTTTTCAT
CTTCTCCAAC TTTTCAAGAA AAAAAAATCC ATATCTTCCA CCCAAGGGTG TCATTTTTGT ATCTCCTTGA AACAAGACTG
TTTCTCTCTG ACTTGATCCA CCTTGTACGG TTTTAATTTA TTTTTACAGA AGGGATAAAC TCTTCTTGGT TTTGGATGAG
AACCAACATA TTTGTATATA TCCTATAGCG GTGCATTATC CAGATCCAAC ACTATTTGAT TATATTCTTT CGCTCATCAG
GCAAAATATC TTGTACAAAA TGGTAATTTT CCTTGGAAAG AATGCTTGAT TTGCTCATAG AGAAAAAAAA AAGTATTGTC
CCCGACATAC ATAGTTTTTC GACGCATGGG GTCATACACA TTTTTGGAAG GAACATGTAC ATAAGATAAT ATTATCTGAG
AGCTTTCTCA TGTATGGATC TACTATACTA CCACAAAAAG AAAGAAATAA TTTCAGGTCA AATTAAACTT TTAGATGCGT
GCAGGTGATT AAAGCTAGCA TCTTTAACCA TTAATTATTG CCTCTCTAGC TTTAGCTAGC TGCTCCATGC GATAATACCC
CAGTGTCTGT ACTGTGCTGC ACACTTGGAG CTATTCCTCT GATTATTGGC TGTGCCCTGA GTGTGCCCAC CTCTCCAAAA
CCGAAATTTT TTATGAATAA ACAAATTTTA ATTAACAAAA AAGGCTTTAA GCTGCTGCCT GTTGCTACCA CATCCTGCAG
CTTTGTCTCT CATTCTGCAC ATGTGCAGAA AGAAGTGGAT CTGCCTGTCA TGTCATTTTC CTCTTTGTTG ATGTTTGCGC
AGGTGGGTCT CTTCTACATA CTCTCTCTAG CTAGCTAGTA GTAGTAGCTA TATTGTGTGT GTGTGAGTAT GCAATATATA
TGCATGCGTC TCTTAGTATG TGTTGTGCTG AAAGAGAGGA GAGTGTGACA TGAACTTTTA ACTGTAAAAG AAGTGTGACA
TGAACTTTTA ACTGTAAAGA TGCCTCCTCT TTTTTCATGC TTTTTTTTTG GAAAGGATGA TTGTACTGTT CACACGACCA
AATCTAACTT ACCTAAGTAT AGATCTCAGT CATCTGCACA TAGATTTCTC TATCTCAATC TCAAGATCTG TCTCTCTGCT
GTGTCTCTCT CTTCCTGTTT GTTTGTGTGT GTGTGTCTGA CTGATGAGAT GAATCTAGGG AGATATTCTT CTTTAGACCT
GATTGAGATG TCATGTCTCT GCCTCCTGGA GGCCTTGAGT GTGTGAGATG CATCATGCAT TGCATGGTAG TAAGAGAAAA
CATGCATATA TGGCTCAAGC TTCTCCAGGC AAAGAGCTAG CTAAGCTCTC AAAAGGGAGA CACACTTGGG AAAAGGTGTT
ATTTGTGCAT GATGGCCAAA TAGGACTCAA AAGACGATAT GGATATGAGA CATGGTGCAA CTTTTGACAT TCCTAGCTAC
TAGCTAGCTA CTTTGTCATC ACACATATAT ATTGACTACA TACACATATA TATTGACTAC ATACACACAT ACACATATAT
ATTGTGAAAC GGTACGTAGC CTAGTGGTTG CAGTGACCTG AGTAACACCC CAAGGTTCTG AGTTcaaata tccatagaag
tgaattttag attgggttat attatggatg gctaagttct ctgtgtgata ggctaagttc ctaatttaaa acgggttatt
tgtgcttgat aggctaagtt tttatccaat tggatataga ggccgggtaa aaaaatacac ttctctaaaa aCACACACAC
ATGCATTGGC ATTTGACAAT TAATATATAT GGATATATAC TTCAATTAAT CTTGTAGCTG CAAGGCTACT ATTTTTTTTC
CAGCAGCATG GTCATCTACT CACCTCTTAT TTGCAGTGCA TGACTGAACA CTGTTGCAGA GAACACATTG AATTATTTGA
AGAGAGACCA GACGGTAGCA TACGTTGATA TACATGTTCA GGCCAATGCT GATACATATA GCTAGCAAGC TAGCTAGCAT
AGCATTTTAG CATTATTTGC TTGGATTCTT GTGGATCGAT CTGCGATAAA TAATTTTATG AACAGTTATA TCTTATACCA
CTATTTAAGA ATCCAATGAA TTTGGACGAA GGGACTAGGG AGTCAATTAA TTAGGACCAG GAGGTAAACA ATAATACTGT
GTGCTTGTGT GGTAACTCTA CCAGACTTAT TAATTGGAGC TACATATTCC ATGTATATAT ATATGTCATG AAATCCTATT
TTTTTCTGTT TTACGTTTCT GATAGAATTA CCCCTATATA TTTTTATTAA TAAGTTTGTT ATGCATATAA TAAATCACAG
TGTTCTGAGA GAGGAAACGA AAAAAATGTA AATGGATAGA TATTATAGGA AAATATAAGA GATTGTGTTT TACTCAATCA
AAAAAAAAAT CAGAAATGTG GTACATGTAA ATACCGAAAT ACGTACCGTA CCTTACTCAT GAACTGAGTA CTGTTGCTTC
TATATGTGTG CAGGTGAATG TGCCAAACAA TTGTTCCTAC AACATTGTGA CTGTTAGATG TGGGCATTGC ACAATGGTGC
TCTCCATGGA TCTTGCTCCT TTTCACCAAG CACGCACTGT TCAAGATCAC CAGGTTTAAA AACTGAAATA ATGGTTTGAA
ATTTCAGTTC AAAACTGTAG CCGAAGAATC TCTTGCatat atatcagcta tatcttattt tttatgaaac aaaacaaatg
aaatattaat ttctgtacgt atgtaaaaaA AAGAATTAAT ATTAATTATT TACTACGTAC AGTGGAATGG TCACATCTAA
ATTTGTTTAT TTAGGTACAG AACAGAGGAT TTCAAGGTAA TAACTTTGGA AGCTATGACA TAGCTTCCAG AAATCAGAGG
ACATCGACAG CCATGTACCC AATGCCAACC AGTCAGCAGC AAGTGTCACC TATACGTCGT ATGCACAATT AATTTTCTCA
TGATTTTATT TCATTGATCT ACTAAATTAT GGGGTTTATT TTTTATTTCT CTATATAAGC ATGCATGCAA AATGGGTATA
TATAATATAG TTAAAGGTTA TATTTACTGT TCTAGGCTTC TAATGTATAA TCAAAATATA TTATAGTAAT CAAGTTCATG
CATGAGCTAT ATATGAACCT GATCACACTG AATTCCAGTA AACATTAGTT TTTTCCCCGT ATACGCATGG AGCTGTGTTA
GATTTCCCAA ATGATCAATC TATAGGTATT AACACACACA CACACACACA CACACACATA CATACACACA CACACAATAC
ATATATTATC AGCTTGCATA ATTTATTAAA TTGCCTTGTT CTTCTGTATT CACATTATAG CTAGTTTTAT GTATTATATA
TATGCTTGTA TAATAGATTT AAAATATTGG TCCTTTTTTC TTCTTTACAG CCCCTGAGAA AAGACAGCGT GTCCCATCTG
CATACAACAG ATTCATCAAG TGAGATTTCA AGCCACACAT GCTTGCTTGA ATAAGTATAT TTTGACACCA AATTAAATAA
TAGTATAAGG TGCTAAATAT ATATTGATAA AGAACCATAA ATAGTCGAAG TGCAGGTACA AACTAATCCC CACTTCAACC
TTTTGGGGAA TATGCATGAG TTCCTAAGAC AGATTAATTA TATTTCTTTC TATCTACCGC AGTGTGCAAT CAAAAAGCTC
CATACACTAC TATATACTCG ACCCTCAGGT CGATTGTGGA CACACACACA AAAAAAAAAG AGTAAAACCT GAATATAATG
ATTGGGTGTT TGGGGGAGGG GGGGGGGATA TTTGAACTCC GACAATGATT AATTTGTGGG CACTTCGTAA TTATATATTA
TTATGTCTAG GCTACTACTT CCTTTTGCGC TCCTTTAATT TGTACACATA ATCTAGTTAG GGCTTGTTCG CTTTCCCTTC
CCATGGGGAT TCAAAAGGGG ATGGGGTGTG GAAGTAATCC CCGAaatccc ttcaatctcc atgggcatgg gattaaccga
acaaaccctt agtgaagtga tcATTTTGGA CCACAAGTTC TGTTGGTAAA TTTTGTGGAA ATGTACTTTA CAAAGTTTTA
TGATCGGTCG TTGTTTGGTC ATTGGATTTT GGAACTTTTT GCTACTAGAT TTTTTTTGAA GTTTATACTT TTGGAATAAT
TATTCTTATT GCTAGGATTT TGTCCGGTGA ATTCTTTATT TTGAAAGAAC ATATTGCAAA TTTAACTTCT TTTGTGTGAA
AAGAAAAGGA ATCTTATTTC GAGTAATTTT TTTCAGTAAA TATGAAACTC TAGATATTTT CAAAAAGGCT AGTTATTGAG
TACCATAAGA AAGGTACCAA AACAAAACTC ACAATGTAAC ATATGTGGTT GGATATTTAT TTATATTTGA TCTTGAGTTT
TTCTTCGGTT TTTAGCAGTA TAGAGGTATA TACCTCTACC GACATGTATA CACCTCATGC CTAACACTAT GATGCACAAA
TACCTATCTG TACCTCCCAA GAACCAGAAA AGTTTTGATG TTGTTGAACT GTATACTTTT ATTCTAATTA GTTCAACTAT
TAGGGATGAA TATACTTATA TATTCAAAGG CAGGAGAAAA CCTCAATTAA GAATGGGGTT AGTGTAAGTG CATGTTTTAT
GACTTTGGTA GACCTTAGTC TATTCGGAAA CGGGAACCAA TAATAATATT TACTATCATC ATTTTCACAA GCCTTTAGTC
TATTAGACAA TATTTTTTAT TTAAATACAT TTAGTTTGCT AAAATCCAAG GAACATATAC ATTATATTGA CTGTGGCAAT
GTAGACATAC AAATATTGAA CTGAGAAAAC ATGTTTTTTT AAAATGGAGA AAACAATTTA AAACCCCCAG TGTCAAACTA
AGAATTCATG GAAATGCAAT TCATATATTA AGTTGTCATA CAACATGCAT TGACCAAACC ATTTTATTAG AGTAATATAA
ATACGCTAGT TTATCTAGAG GTTCATGTTG CAAGATTGTA AATAAGATTT CAGTAATATA TATATGAGAC TTGTTCTTTT
AAAATAACAA ATCGTGTATA TATCAAATTG TTCAATGCCA CATATATATA TATGATGAAT GAGTAAATTC AACTTCATTT
GGAGTATGTA TAGCTATGCT CTAATTAATT ATGTGCACCG ATTTTTTTTT GTCCTTTTGG TCTGCAGCGC GCTAGCTATC
ATGTATGTAC ATGTATATAT ATGTGATGAG ATCTATTTTA GACGCATGCA TGTAATATGT GTGTTTTCTT AATTGGATCG
TTATGCTTCT CTAATCTCTC TATATACACA Gacgacagaa acagatatat gtttaaatgc aaaagaatta aatgcaagta
tatatgttaa attaagatta aatctcaaga agCTGATTTA ATTTAATTCT TGTCAATATC AACAGGGAGG AGATACAGAG
GATTAAAACC AGCAATCCTG AGATTAGCCA CAGGGAGGCA TTCAGTGCTG CTGCAAAGAA CGTAAGTACT CTAATTGTAA
ATACTTTTCT CTAACTAATT AGATGTTGCA GGCAGTCAGG ACATACTAta ctccttcaat cccaaaagat agtgcataaa
tattttcttt cttatctcat aatacgtcca tacatgcaaa ttaactaaca accccccccc cctcctcctc taaattcgtt
attttaattT TACCCACAAA ATTTTTTtat tttaatttta ttattgttat acggtttagt taagatgaat tcactatagg
aatttgctta gatatatata tttttttaga aaatcatgaa ttagtaatcc gatcatctca agttagcata cgagtttttt
tttaaaaaaa tatcttatac aactccttct atatttccaa aaggtagcga acttaaaacc tgactaaaaa gggagcgaac
ttaaaacccc actcaaatac ggatatgtat ttccaaaatc gaacgaactt aaaagcgact taattataga cggatgacgt
accaaagtac cggcaaaaac atcttcaatt tttataatag tagagATTAG GTGCATGCTT TGTGTTCATT ATGAGTAATC
TAAACAGATC AAAGCTATGA TAATAATTAG TATTTCTTAT CTTTAGATTA GTGGTGGTTG TTACTTATAT TTTGTGTCTT
AAAGAAAAAC TTTTGTACAA TTAAGCTTTC TGCAATTAGG ATCAACTAAT TAATTATGAT ATCTATCTAT AATTTCTCAT
GCGTATAATA TGCAGTGGGC TCATCTTCCC CGGCTCCATT TTGGCCTCAG CGTCGCCGAC GGCGGCGGCG GCGGCGGCAG
CAACTAATCG CGGCGGCGCG GCCTGCCGGC CGGCCACCGA TCGCCGGCGT GCACGCCGGC GCGCGGCGGC GGCCGGTCGA
GAATGCGCGC GCAGGAGGGA CGACGACGAT ATATTATTAT CGCGTGTGCC CCTCTCTCTT CGCCGCGTAA TTAATTAATC
AGTTAATTAA TTACGTACGA CCTACTGTGT TATGCTATCG ATCCGTGTTA ATTAATTACC TACGTATCTT GATTAATTAG
TCTCGTATTA TACGTACTAT TATACGTACG TGCTGTGCTA TGTACGTAGA CAACAAAAAA AAATGTGCGT GATGAGTTCT
AC

Locus: Os07g0160100

Loading...

Locus: Os07g0160100

Loading...