Os07t0160100-03

Locus

Os07g0160100

Description

Similar to MADS-box transcription factor.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

YAB1

CGSNL Gene Name

YABBY1

Oryzabase Gene Symbol Synonym(s)

OsYAB1, FIL1, osFIL1

Oryzabase Gene Name Synonym(s)

YABBY1 gene, YABBY 1, OsYABBY1, Os YABBY1, FILAMENTOUS FLOWER 1, Protein YABBY 1, Protein FILAMENTOUS FLOWER 1, FIL homolog 1

Transcript Evidence

AK100222 (DDBJ, Best hit)

Protein Evidence

D3U2G4 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

High mobility group, HMG1/HMG2 (IPR000910)

YABBY protein (IPR006780)

High mobility group, superfamily (IPR009071)

Full-length cDNA

J023047G10 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0160100-03)

Others

Oryzabase (6310)

Transcript

1808 bp

>Os07t0160100-03 Similar to MADS-box transcription factor.
TACATATCTCTCCCTTGCTTGCTTTGCTCCTGGATATATAGCTAGCTTCTTTCTTTCTTC
CTCTCTCCCTGTGTGGCACGCGCCTCCAATCGATCTCTTCGGTGAGTAGACGCATCGAGA
TCGGGGGGAAATGTCGGTCCAGTTTACATCGGAGCATGTTTGCTATGTCAACTGCAACTA
TTGCAACACTATCCTTGTGGTGAATGTGCCAAACAATTGTTCCTACAACATTGTGACTGT
TAGATGTGGGCATTGCACAATGGTGCTCTCCATGGATCTTGCTCCTTTTCACCAAGCACG
CACTGTTCAAGATCACCAGGTTTAAAAACTGAAATAATGGTTTGAAATTTCAGTTCAAAA
CTGTAGCCGAAGAATCTCTTGCatatatatcagctatatcttattttttatgaaacaaaa
caaatgaaatattaatttctgtacgtatgtaaaaaAAAGAATTAATATTAATTATTTACT
ACGTACAGTGGAATGGTCACATCTAAATTTGTTTATTTAGGTACAGAACAGAGGATTTCA
AGGTAATAACTTTGGAAGCTATGACATAGCTTCCAGAAATCAGAGGACATCGACAGCCAT
GTACCCAATGCCAACCAGTCAGCAGCAAGTGTCACCTATACGTCGTATGCACAATTAATT
TTCTCATGATTTTATTTCATTGATCTACTAAATTATGGGGTTTATTTTTTATTTCTCTAT
ATAAGCATGCATGCAAAATGGGTATATATAATATAGTTAAAGGTTATATTTACTGTTCTA
GGCTTCTAATGTATAATCAAAATATATTATAGTAATCAAGTTCATGCATGAGCTATATAT
GAACCTGATCACACTGAATTCCAGTAAACATTAGTTTTTTCCCCGTATACGCATGGAGCT
GTGTTAGATTTCCCAAATGATCAATCTATAGGTATTAACACACACACACACACACACACA
CACATACATACACACACACACAATACATATATTATCAGCTTGCATAATTTATTAAATTGC
CTTGTTCTTCTGTATTCACATTATAGCTAGTTTTATGTATTATATATATGCTTGTATAAT
AGATTTAAAATATTGGTCCTTTTTTCTTCTTTACAGCCCCTGAGAAAAGACAGCGTGTCC
CATCTGCATACAACAGATTCATCAAGGAGGAGATACAGAGGATTAAAACCAGCAATCCTG
AGATTAGCCACAGGGAGGCATTCAGTGCTGCTGCAAAGAACTGGGCTCATCTTCCCCGGC
TCCATTTTGGCCTCAGCGTCGCCGACGGCGGCGGCGGCGGCGGCAGCAACTAATCGCGGC
GGCGCGGCCTGCCGGCCGGCCACCGATCGCCGGCGTGCACGCCGGCGCGCGGCGGCGGCC
GGTCGAGAATGCGCGCGCAGGAGGGACGACGACGATATATTATTATCGCGTGTGCCCCTC
TCTCTTCGCCGCGTAATTAATTAATCAGTTAATTAATTACGTACGACCTACTGTGTTATG
CTATCGATCCGTGTTAATTAATTACCTACGTATCTTGATTAATTAGTCTCGTATTATACG
TACTATTATACGTACGTGCTGTGCTATGTACGTAGACAACAAAAAAAAATGTGCGTGATG
AGTTCTACTACGTACGTACGTACTGTGTTCTAGTGTTTTAATTTGTATCCGAACCAAGGA
GTTGTTTAATTAACTGCATGCACATGCACTGGACTTGAATCTGGAGTATTATGTAAGTGT
GCATGCATGCTGGATTATGCAAAATAAACGAATTAATGAATAGAACTGTTTTTGTTAATT
AATTAATT

CDS

225 bp

>Os07t0160100-03 Similar to MADS-box transcription factor.
AATATTGGTCCTTTTTTCTTCTTTACAGCCCCTGAGAAAAGACAGCGTGTCCCATCTGCA
TACAACAGATTCATCAAGGAGGAGATACAGAGGATTAAAACCAGCAATCCTGAGATTAGC
CACAGGGAGGCATTCAGTGCTGCTGCAAAGAACTGGGCTCATCTTCCCCGGCTCCATTTT
GGCCTCAGCGTCGCCGACGGCGGCGGCGGCGGCGGCAGCAACTAA

Protein

74 aa

>Os07t0160100-03 Similar to MADS-box transcription factor.
NIGPFFFFTAPEKRQRVPSAYNRFIKEEIQRIKTSNPEISHREAFSAAAKNWAHLPRLHF
GLSVADGGGGGGSN*

5'UTR

chr07:3221777..3221975 (+ strand) : 199 bp

chr07:3224909..3225797 (+ strand) : 889 bp

CDS

chr07:3225798..3225874 (+ strand) : 77 bp

chr07:3227841..3227916 (+ strand) : 76 bp

chr07:3228671..3228742 (+ strand) : 72 bp

3'UTR

chr07:3228743..3229237 (+ strand) : 495 bp

FASTA

>Os07t0160100-03 class=Sequence position=chr07:3221777..3229237 (+ strand)
TACATATCTC TCCCTTGCTT GCTTTGCTCC TGGATATATA GCTAGCTTCT TTCTTTCTTC CTCTCTCCCT GTGTGGCACG
CGCCTCCAAT CGATCTCTTC GGTGAGTAGA CGCATCGAGA TCGGGGGGAA ATGTCGGTCC AGTTTACATC GGAGCATGTT
TGCTATGTCA ACTGCAACTA TTGCAACACT ATCCTTGTGG TATCGTCTTC CTCCCTCATC TCTTTCTCTC TCTAGCTCTC
TCTCTCTCTC TCATATCTTG TGTATTTCTG TTCTAATTTG AGGTGTTTGC CGGATCTATA TGGGGAGTTC AATTTTTTTG
TATATTTTTT TGAAGGGGCT AATGCGTGCA TGCTGTAGTC CATGCATAGA GGTAGCCTAA GCTAGGGGAA AATAAGCACC
CTAATCAAGT ATGCTAGCTA CTTGTTTACT AAACTAATTG CACTTTGTTT TGTCCTGGAT AAGTTTGTAA TTTTATATTT
CTGGAGAGTT CTCCAGTACA TCGAAATCCA GCAATCCGGT CTTTTTGCAT AAACTTCCAT GTACATGGTA ACAGAAATGC
ACAGATTTTC TTTATGGCAA ACATAAAATC ATATAAATAG AAGGATATTG CAAACATACT TTGTACTATT TCTTTTCATC
TTCTCCAACT TTTCAAGAAA AAAAAATCCA TATCTTCCAC CCAAGGGTGT CATTTTTGTA TCTCCTTGAA ACAAGACTGT
TTCTCTCTGA CTTGATCCAC CTTGTACGGT TTTAATTTAT TTTTACAGAA GGGATAAACT CTTCTTGGTT TTGGATGAGA
ACCAACATAT TTGTATATAT CCTATAGCGG TGCATTATCC AGATCCAACA CTATTTGATT ATATTCTTTC GCTCATCAGG
CAAAATATCT TGTACAAAAT GGTAATTTTC CTTGGAAAGA ATGCTTGATT TGCTCATAGA GAAAAAAAAA AGTATTGTCC
CCGACATACA TAGTTTTTCG ACGCATGGGG TCATACACAT TTTTGGAAGG AACATGTACA TAAGATAATA TTATCTGAGA
GCTTTCTCAT GTATGGATCT ACTATACTAC CACAAAAAGA AAGAAATAAT TTCAGGTCAA ATTAAACTTT TAGATGCGTG
CAGGTGATTA AAGCTAGCAT CTTTAACCAT TAATTATTGC CTCTCTAGCT TTAGCTAGCT GCTCCATGCG ATAATACCCC
AGTGTCTGTA CTGTGCTGCA CACTTGGAGC TATTCCTCTG ATTATTGGCT GTGCCCTGAG TGTGCCCACC TCTCCAAAAC
CGAAATTTTT TATGAATAAA CAAATTTTAA TTAACAAAAA AGGCTTTAAG CTGCTGCCTG TTGCTACCAC ATCCTGCAGC
TTTGTCTCTC ATTCTGCACA TGTGCAGAAA GAAGTGGATC TGCCTGTCAT GTCATTTTCC TCTTTGTTGA TGTTTGCGCA
GGTGGGTCTC TTCTACATAC TCTCTCTAGC TAGCTAGTAG TAGTAGCTAT ATTGTGTGTG TGTGAGTATG CAATATATAT
GCATGCGTCT CTTAGTATGT GTTGTGCTGA AAGAGAGGAG AGTGTGACAT GAACTTTTAA CTGTAAAAGA AGTGTGACAT
GAACTTTTAA CTGTAAAGAT GCCTCCTCTT TTTTCATGCT TTTTTTTTGG AAAGGATGAT TGTACTGTTC ACACGACCAA
ATCTAACTTA CCTAAGTATA GATCTCAGTC ATCTGCACAT AGATTTCTCT ATCTCAATCT CAAGATCTGT CTCTCTGCTG
TGTCTCTCTC TTCCTGTTTG TTTGTGTGTG TGTGTCTGAC TGATGAGATG AATCTAGGGA GATATTCTTC TTTAGACCTG
ATTGAGATGT CATGTCTCTG CCTCCTGGAG GCCTTGAGTG TGTGAGATGC ATCATGCATT GCATGGTAGT AAGAGAAAAC
ATGCATATAT GGCTCAAGCT TCTCCAGGCA AAGAGCTAGC TAAGCTCTCA AAAGGGAGAC ACACTTGGGA AAAGGTGTTA
TTTGTGCATG ATGGCCAAAT AGGACTCAAA AGACGATATG GATATGAGAC ATGGTGCAAC TTTTGACATT CCTAGCTACT
AGCTAGCTAC TTTGTCATCA CACATATATA TTGACTACAT ACACATATAT ATTGACTACA TACACACATA CACATATATA
TTGTGAAACG GTACGTAGCC TAGTGGTTGC AGTGACCTGA GTAACACCCC AAGGTTCTGA GTTcaaatat ccatagaagt
gaattttaga ttgggttata ttatggatgg ctaagttctc tgtgtgatag gctaagttcc taatttaaaa cgggttattt
gtgcttgata ggctaagttt ttatccaatt ggatatagag gccgggtaaa aaaatacact tctctaaaaa CACACACACA
TGCATTGGCA TTTGACAATT AATATATATG GATATATACT TCAATTAATC TTGTAGCTGC AAGGCTACTA TTTTTTTTCC
AGCAGCATGG TCATCTACTC ACCTCTTATT TGCAGTGCAT GACTGAACAC TGTTGCAGAG AACACATTGA ATTATTTGAA
GAGAGACCAG ACGGTAGCAT ACGTTGATAT ACATGTTCAG GCCAATGCTG ATACATATAG CTAGCAAGCT AGCTAGCATA
GCATTTTAGC ATTATTTGCT TGGATTCTTG TGGATCGATC TGCGATAAAT AATTTTATGA ACAGTTATAT CTTATACCAC
TATTTAAGAA TCCAATGAAT TTGGACGAAG GGACTAGGGA GTCAATTAAT TAGGACCAGG AGGTAAACAA TAATACTGTG
TGCTTGTGTG GTAACTCTAC CAGACTTATT AATTGGAGCT ACATATTCCA TGTATATATA TATGTCATGA AATCCTATTT
TTTTCTGTTT TACGTTTCTG ATAGAATTAC CCCTATATAT TTTTATTAAT AAGTTTGTTA TGCATATAAT AAATCACAGT
GTTCTGAGAG AGGAAACGAA AAAAATGTAA ATGGATAGAT ATTATAGGAA AATATAAGAG ATTGTGTTTT ACTCAATCAA
AAAAAAAATC AGAAATGTGG TACATGTAAA TACCGAAATA CGTACCGTAC CTTACTCATG AACTGAGTAC TGTTGCTTCT
ATATGTGTGC AGGTGAATGT GCCAAACAAT TGTTCCTACA ACATTGTGAC TGTTAGATGT GGGCATTGCA CAATGGTGCT
CTCCATGGAT CTTGCTCCTT TTCACCAAGC ACGCACTGTT CAAGATCACC AGGTTTAAAA ACTGAAATAA TGGTTTGAAA
TTTCAGTTCA AAACTGTAGC CGAAGAATCT CTTGCatata tatcagctat atcttatttt ttatgaaaca aaacaaatga
aatattaatt tctgtacgta tgtaaaaaAA AGAATTAATA TTAATTATTT ACTACGTACA GTGGAATGGT CACATCTAAA
TTTGTTTATT TAGGTACAGA ACAGAGGATT TCAAGGTAAT AACTTTGGAA GCTATGACAT AGCTTCCAGA AATCAGAGGA
CATCGACAGC CATGTACCCA ATGCCAACCA GTCAGCAGCA AGTGTCACCT ATACGTCGTA TGCACAATTA ATTTTCTCAT
GATTTTATTT CATTGATCTA CTAAATTATG GGGTTTATTT TTTATTTCTC TATATAAGCA TGCATGCAAA ATGGGTATAT
ATAATATAGT TAAAGGTTAT ATTTACTGTT CTAGGCTTCT AATGTATAAT CAAAATATAT TATAGTAATC AAGTTCATGC
ATGAGCTATA TATGAACCTG ATCACACTGA ATTCCAGTAA ACATTAGTTT TTTCCCCGTA TACGCATGGA GCTGTGTTAG
ATTTCCCAAA TGATCAATCT ATAGGTATTA ACACACACAC ACACACACAC ACACACATAC ATACACACAC ACACAATACA
TATATTATCA GCTTGCATAA TTTATTAAAT TGCCTTGTTC TTCTGTATTC ACATTATAGC TAGTTTTATG TATTATATAT
ATGCTTGTAT AATAGATTTA AAATATTGGT CCTTTTTTCT TCTTTACAGC CCCTGAGAAA AGACAGCGTG TCCCATCTGC
ATACAACAGA TTCATCAAGT GAGATTTCAA GCCACACATG CTTGCTTGAA TAAGTATATT TTGACACCAA ATTAAATAAT
AGTATAAGGT GCTAAATATA TATTGATAAA GAACCATAAA TAGTCGAAGT GCAGGTACAA ACTAATCCCC ACTTCAACCT
TTTGGGGAAT ATGCATGAGT TCCTAAGACA GATTAATTAT ATTTCTTTCT ATCTACCGCA GTGTGCAATC AAAAAGCTCC
ATACACTACT ATATACTCGA CCCTCAGGTC GATTGTGGAC ACACACACAA AAAAAAAAGA GTAAAACCTG AATATAATGA
TTGGGTGTTT GGGGGAGGGG GGGGGGATAT TTGAACTCCG ACAATGATTA ATTTGTGGGC ACTTCGTAAT TATATATTAT
TATGTCTAGG CTACTACTTC CTTTTGCGCT CCTTTAATTT GTACACATAA TCTAGTTAGG GCTTGTTCGC TTTCCCTTCC
CATGGGGATT CAAAAGGGGA TGGGGTGTGG AAGTAATCCC CGAaatccct tcaatctcca tgggcatggg attaaccgaa
caaaccctta gtgaagtgat cATTTTGGAC CACAAGTTCT GTTGGTAAAT TTTGTGGAAA TGTACTTTAC AAAGTTTTAT
GATCGGTCGT TGTTTGGTCA TTGGATTTTG GAACTTTTTG CTACTAGATT TTTTTTGAAG TTTATACTTT TGGAATAATT
ATTCTTATTG CTAGGATTTT GTCCGGTGAA TTCTTTATTT TGAAAGAACA TATTGCAAAT TTAACTTCTT TTGTGTGAAA
AGAAAAGGAA TCTTATTTCG AGTAATTTTT TTCAGTAAAT ATGAAACTCT AGATATTTTC AAAAAGGCTA GTTATTGAGT
ACCATAAGAA AGGTACCAAA ACAAAACTCA CAATGTAACA TATGTGGTTG GATATTTATT TATATTTGAT CTTGAGTTTT
TCTTCGGTTT TTAGCAGTAT AGAGGTATAT ACCTCTACCG ACATGTATAC ACCTCATGCC TAACACTATG ATGCACAAAT
ACCTATCTGT ACCTCCCAAG AACCAGAAAA GTTTTGATGT TGTTGAACTG TATACTTTTA TTCTAATTAG TTCAACTATT
AGGGATGAAT ATACTTATAT ATTCAAAGGC AGGAGAAAAC CTCAATTAAG AATGGGGTTA GTGTAAGTGC ATGTTTTATG
ACTTTGGTAG ACCTTAGTCT ATTCGGAAAC GGGAACCAAT AATAATATTT ACTATCATCA TTTTCACAAG CCTTTAGTCT
ATTAGACAAT ATTTTTTATT TAAATACATT TAGTTTGCTA AAATCCAAGG AACATATACA TTATATTGAC TGTGGCAATG
TAGACATACA AATATTGAAC TGAGAAAACA TGTTTTTTTA AAATGGAGAA AACAATTTAA AACCCCCAGT GTCAAACTAA
GAATTCATGG AAATGCAATT CATATATTAA GTTGTCATAC AACATGCATT GACCAAACCA TTTTATTAGA GTAATATAAA
TACGCTAGTT TATCTAGAGG TTCATGTTGC AAGATTGTAA ATAAGATTTC AGTAATATAT ATATGAGACT TGTTCTTTTA
AAATAACAAA TCGTGTATAT ATCAAATTGT TCAATGCCAC ATATATATAT ATGATGAATG AGTAAATTCA ACTTCATTTG
GAGTATGTAT AGCTATGCTC TAATTAATTA TGTGCACCGA TTTTTTTTTG TCCTTTTGGT CTGCAGCGCG CTAGCTATCA
TGTATGTACA TGTATATATA TGTGATGAGA TCTATTTTAG ACGCATGCAT GTAATATGTG TGTTTTCTTA ATTGGATCGT
TATGCTTCTC TAATCTCTCT ATATACACAG acgacagaaa cagatatatg tttaaatgca aaagaattaa atgcaagtat
atatgttaaa ttaagattaa atctcaagaa gCTGATTTAA TTTAATTCTT GTCAATATCA ACAGGGAGGA GATACAGAGG
ATTAAAACCA GCAATCCTGA GATTAGCCAC AGGGAGGCAT TCAGTGCTGC TGCAAAGAAC GTAAGTACTC TAATTGTAAA
TACTTTTCTC TAACTAATTA GATGTTGCAG GCAGTCAGGA CATACTAtac tccttcaatc ccaaaagata gtgcataaat
attttctttc ttatctcata atacgtccat acatgcaaat taactaacaa cccccccccc ctcctcctct aaattcgtta
ttttaattTT ACCCACAAAA TTTTTTtatt ttaattttat tattgttata cggtttagtt aagatgaatt cactatagga
atttgcttag atatatatat ttttttagaa aatcatgaat tagtaatccg atcatctcaa gttagcatac gagttttttt
ttaaaaaaat atcttataca actccttcta tatttccaaa aggtagcgaa cttaaaacct gactaaaaag ggagcgaact
taaaacccca ctcaaatacg gatatgtatt tccaaaatcg aacgaactta aaagcgactt aattatagac ggatgacgta
ccaaagtacc ggcaaaaaca tcttcaattt ttataatagt agagATTAGG TGCATGCTTT GTGTTCATTA TGAGTAATCT
AAACAGATCA AAGCTATGAT AATAATTAGT ATTTCTTATC TTTAGATTAG TGGTGGTTGT TACTTATATT TTGTGTCTTA
AAGAAAAACT TTTGTACAAT TAAGCTTTCT GCAATTAGGA TCAACTAATT AATTATGATA TCTATCTATA ATTTCTCATG
CGTATAATAT GCAGTGGGCT CATCTTCCCC GGCTCCATTT TGGCCTCAGC GTCGCCGACG GCGGCGGCGG CGGCGGCAGC
AACTAATCGC GGCGGCGCGG CCTGCCGGCC GGCCACCGAT CGCCGGCGTG CACGCCGGCG CGCGGCGGCG GCCGGTCGAG
AATGCGCGCG CAGGAGGGAC GACGACGATA TATTATTATC GCGTGTGCCC CTCTCTCTTC GCCGCGTAAT TAATTAATCA
GTTAATTAAT TACGTACGAC CTACTGTGTT ATGCTATCGA TCCGTGTTAA TTAATTACCT ACGTATCTTG ATTAATTAGT
CTCGTATTAT ACGTACTATT ATACGTACGT GCTGTGCTAT GTACGTAGAC AACAAAAAAA AATGTGCGTG ATGAGTTCTA
CTACGTACGT ACGTACTGTG TTCTAGTGTT TTAATTTGTA TCCGAACCAA GGAGTTGTTT AATTAACTGC ATGCACATGC
ACTGGACTTG AATCTGGAGT ATTATGTAAG TGTGCATGCA TGCTGGATTA TGCAAAATAA ACGAATTAAT GAATAGAACT
GTTTTTGTTA ATTAATTAAT T

Locus: Os07g0160100

Loading...

Locus: Os07g0160100

Loading...