Os07t0166800-01

Locus

Os07g0166800

Description

Rad6 (Ubiquitin carrier protein).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBC7

CGSNL Gene Name

UBIQUITIN-CONJUGATING ENZYME 7

Oryzabase Gene Symbol Synonym(s)

OsUBC7

Oryzabase Gene Name Synonym(s)

Ubiquitin-conjugating enzyme 7

Transcript Evidence

AK121382 (DDBJ, Best hit)

Protein Evidence

C5XAB9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid-amino acid ligase activity (GO:0016881)

Functional domain (InterPro)

Ubiquitin-conjugating enzyme, E2 (IPR000608)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme, active site (IPR023313)

Full-length cDNA

J023127H21 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0166800-01)

RiceXPro (AK121382)

Others

Oryzabase (19555)

KEGG (Os07t0166800-01 (EC:6.3.2.19))

Transcript

894 bp

>Os07t0166800-01 Rad6 (Ubiquitin carrier protein).
ACGCGCAGCGATTCCACCCCCACCGCCACCCGCGACCACAGACTCCACGATTCTCTCAGA
GAGAGAGAGAGAGAGAGAGAGGGGACTCAGCGAGCGGTGGGCGAGAGGGGGAGATCGAAA
CCCTAGCTAGGGTTTGCGCGCGGCGGCGGCGGGGATGTCGACGCCGGCGAGGAAGCGGCT
GATGCGGGACTTCAAGCGGCTGCAGCAGGACCCCCCCGCGGGGATCAGCGGCGCGCCGCA
CGACAACAACATCATGCTCTGGAACGCCGTCATCTTCGGGCCGGATGATACGCCGTGGGA
CGGAGGCACGTTCAAGCTTACCTTGCAGTTTACAGAAGATTATCCCAACAAGCCGCCGAC
TGTTCGGTTTGTTTCTAGGATGTTCCACCCAAATATTTATGCAGATGGAAGCATCTGCTT
GGATATTCTACAGAACCAGTGGAGCCCTATATATGATGTTGCTGCCATATTGACTTCAAT
TCAGTCTTTGCTGTGTGATCCAAACCCCAACTCTCCAGCAAACTCAGAAGCTGCCAGACT
GTTTAGTGAGAACAAGCGAGAGTACAACCGCAAGGTTCGTGAGATCGTGGAGCAGAGCTG
GACAGCTGACTAGGGCATGCAGCAGGGCAACGGGTGGTATCCACCATGCCAGAAAGATGC
AATAAGCAACCGTGAAAAACCTGTGCGTTTCTGGCTCTCCAGATTTGCTGTCATCTTAAA
ACATTATAAGATCTCCAGTGATTGCTTGTAGTCCGTTGATGTTTTTGTGTTCCCATGTCC
CAGTTACTCTTGGCTGCTTTTATGTAGTGGTGTTGACCTCTCATGCACTAGGGCATTCTG
CTCATGTAAAAAGGGGATTATCATCATAATATGTGAATGGAAGCGAAATGGGTC

CDS

459 bp

>Os07t0166800-01 Rad6 (Ubiquitin carrier protein).
ATGTCGACGCCGGCGAGGAAGCGGCTGATGCGGGACTTCAAGCGGCTGCAGCAGGACCCC
CCCGCGGGGATCAGCGGCGCGCCGCACGACAACAACATCATGCTCTGGAACGCCGTCATC
TTCGGGCCGGATGATACGCCGTGGGACGGAGGCACGTTCAAGCTTACCTTGCAGTTTACA
GAAGATTATCCCAACAAGCCGCCGACTGTTCGGTTTGTTTCTAGGATGTTCCACCCAAAT
ATTTATGCAGATGGAAGCATCTGCTTGGATATTCTACAGAACCAGTGGAGCCCTATATAT
GATGTTGCTGCCATATTGACTTCAATTCAGTCTTTGCTGTGTGATCCAAACCCCAACTCT
CCAGCAAACTCAGAAGCTGCCAGACTGTTTAGTGAGAACAAGCGAGAGTACAACCGCAAG
GTTCGTGAGATCGTGGAGCAGAGCTGGACAGCTGACTAG

Protein

153 aa

>Os07t0166800-01 Rad6 (Ubiquitin carrier protein).
MSTPARKRLMRDFKRLQQDPPAGISGAPHDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT
EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNS
PANSEAARLFSENKREYNRKVREIVEQSWTAD*

5'UTR

chr07:3593730..3593883 (- strand) : 154 bp

CDS

chr07:3593605..3593729 (- strand) : 125 bp

chr07:3593370..3593395 (- strand) : 26 bp

chr07:3590628..3590717 (- strand) : 90 bp

chr07:3590420..3590508 (- strand) : 89 bp

chr07:3589646..3589774 (- strand) : 129 bp

3'UTR

chr07:3589365..3589645 (- strand) : 281 bp

FASTA

>Os07t0166800-01 class=Sequence position=chr07:3589365..3593883 (- strand)
ACGCGCAGCG ATTCCACCCC CACCGCCACC CGCGACCACA GACTCCACGA TTCTCTCAGA GAGAGAGAGA GAGAGAGAGA
GGGGACTCAG CGAGCGGTGG GCGAGAGGGG GAGATCGAAA CCCTAGCTAG GGTTTGCGCG CGGCGGCGGC GGGGATGTCG
ACGCCGGCGA GGAAGCGGCT GATGCGGGAC TTCAAGCGGC TGCAGCAGGA CCCCCCCGCG GGGATCAGCG GCGCGCCGCA
CGACAACAAC ATCATGCTCT GGAACGCCGT CATCTTCGGG TGGGTGTCAG CCATGGACGC GGAATTCCCA TCTGCCTCTA
CCTCTCTCCC CCCCTCCCCC TCTCCTGCGC CGGCCCCCCG GTGTTCTAGG GTTTCGGTGT CCCCGGATCT CGGGGGACCC
GAGGTTTTCA GCTGTTTTTT TTTGTTTTTT TGTTGTAGTG GCTGTGGTGC TAACGAGGAA TTGTTTTCCG TGTGATGATG
TTTTGCAGGC CGGATGATAC GCCGTGGGAC GGAGGTGAGG CTTGCTCGGT TTGGTTTTGC TCCGATCTGT AGCTGGTTTA
GTGATTAGGT TGTGGTTTAC TAATTCCTTG GGGATGGTTC GATGTGGAAA TTGGAATCGT TAGGATGGAT ATAGCATCAT
GAGTATTTTG CCCAGGGAGA TGAGACCGAG TGAGTGGGCA GCTGATTCCA CATAAACTTA GAAGGCAGAT GAGGATTGTC
TGTTGTTGTC TATGTCGGTC TTGTCGGATA TGTGGGGAGA TCGAGCCATG CAATTCTGGA AGGGTCATTA CAGGGTTAGG
CTATTGGCTA GATGTATGAA TTCCTTAACA CGTAAAATTG AAAACGACAA AAATACATGG CATACTTATG ATGCCTGTCA
CCTAAGCAGC TCTAATTGAG GTGCGCTGAA ACTGTCATTT GGTAATTTTG GTTTATGTGA ATTCTACATG ATAATTGCTA
GAGTAGGCAT GGTTTCATTA GACTAGTCAA CAAATGAACC TTGCCATATC TATCACATAT TCAATAACAG AAATGCCGAT
Ttaggtcctg ttcgaatcca ctgaaagaag tgtataaact tttgggtaaa agtggcacgc ttttcaaatt gctaaacggt
gcgtttcgtg cgaaagcttt ctatatgaaa gttgttctaa aatatcagat taatccattt tttcaagttt gtaataatta
aaactcaatt aatcgcactt tattaccacc tcattttgcg tgaaacactt aatccttatc ttcatcttca tcttcaggag
attcaaacac caccttaAAC ATACTCTAGA AATTAGAGTG ACTGCTGCAT TTACTGTCTA AAATGGAGTA ATAAAGTTGG
GAGTTGGTGT GAGCTTGCCT GGGAAGTAGG TTGCATGTTT GGTTCAGGAA GGTAGGTTCT ACTATTTGAA ATATATTGTT
TTGGAAGTGC ATAACACATG AAGGAATAAA TAACCTACAA ATAATTATGG ATAGAGTTAA CCATGTTGCC ATGTGACACT
TATTGTGCAT GTTTTGAGCA TGTGGTGCCC CGAATTATCT GTTCGACAAA TCAGGGCACT GTATATTTTT TGCTGTTTTG
TCTTAATCAG TTCGCAACGA ACTTAACTAT TTGACTGAAT CTGATTATGA TCTGCACATA TATAAATTTA AGTTAAGTTA
TGGTGTCAGA TATTTTCCAA CAACTAACAT TGCCCTTTTT ATGGAAAAGA ACTTTCTGTT TTTTTCTCAG AGTTCAGGTC
TTCTTCTTTT CCCCTCTTCT ATTTGAGTTG CGTAAACCTC AAGTTACGTC TTAGATATAT GATTGATGAT ACTACGGTTC
TGTTGCACAA ACCAATTTGT AAGGATGGAT GTTAAATCCT CTATGCAAAT CTTGGTGCCT GTTTATTTTA TACTGTTTAT
GTAGGTTTTA GTGTAAGTTG AGCTGTTTAA AAGATTTACT TTGTTTTGCT TTTGAGTTTC AGTCTTGTTT TGAAAATAAA
ATGAGTACAC ACTTATCTTT TAAATGCATA GCTTAACTGC ATGCCTACAG TGCAAGAACC CTTAAAATTC TTAGGCCATG
ATCCTACCAA AAGAAAAGAG AATGTCATGA TGATGTGGTT ATGTTATGGG CGTAGAAAAA GGATACTAGT GGGAATGCTT
GGGTTTGCGT CAAATTTTAC TTCATTTCTT CTCTGTGGTT GTTTATTCCA GTGTTGTTGA GGCGGTAATG CAGTTTAAGG
CAACCCACCA CTGCGAGGCG TAAGGCGTTG CGACGCCCTA TGAGATGGTT GAGGCATGAT TAATGGAGGA TATGGTAGAG
AAATTAGGAA GAAAAAAAGG GAAACCGGTA AAAGGCCCAC TAATCCAGGC AGCCAGCCCA CCAAAGCCCA ACATAAGTCT
TCATACCTAC GTGTTCTATG CCCTAAGAGG CATCTTACTC CACCAGGCAC CAGCTGCCAT GATGAGAAGA GGAGTCCCCA
GCTGCTGGCC TCATCCACAT GACCTCTACT AGGGTTCTAG GATGAGCTTA CCTCTTCTTC TTTCCCTTTC TTTATTGGTT
TTGCTTGTAA GGCCTTTTTC TTTCCCTTTC TTCACAGTGG ACACCTTGGC CTCTGTGACC GCCTTAGCGC TATACGCCTT
AACAACCTGG GTTTATTCTT TAATTCTTCT CATGTGAAAT CCTTGTCTGT AATGTAGTAA TGTTGTATGA CATATTATCT
TCCCTACAAC TCTATCTGCA TTATGTGATA CTGCTGCAGT TCTGTACCCC TATAGTCAGG CCATACAGTT AAATACTCAG
AGCCAGGAGA GCTTGCACTA GCACTATTAT TTTTATATGA TGAAAGATGT GGTCTTTTGT GTATTGGTTC CTGATTGTTC
TTATCTATCA TTGATCTATT GCTTATATGA CATTTCTTTA GCCTTTGTTG TTTAATTTCA TTAGTTATAG ATAGCCTTGA
ATCATCTACA GTACGGCAAA AGTGATGAAT GCAGATGTTT GGGAATTCGG GATTATGGTT ATTAGTAAGA CAATAGTTCT
GATACAGGAC AACAGACAAC CAAAAGCCAC ATAATGATTA ATCATGCTTC AACTTTTTGT AGCTACCAGT CTGCCAGCAT
GGTAACTTGA GAAGTCGACT AACAGTTAAC TCTTACGTAT CTGTAGGCAC GTTCAAGCTT ACCTTGCAGT TTACAGAAGA
TTATCCCAAC AAGCCGCCGA CTGTTCGGTT TGTTTCTAGG ATGTTCCACC CAAATAGTAA GCTCTCTTCC CGTGTGATTA
TATATTGTTC AATAATTACC TTACATTTGT AAACAAATAA AGATCTTCGT TTTTGAATAA TGGAAAACTT ATTTAACATC
ATACTATTCA TGCAGTTTAT GCAGATGGAA GCATCTGCTT GGATATTCTA CAGAACCAGT GGAGCCCTAT ATATGATGTT
GCTGCCATAT TGACTTCAAT TCAGGTACCT TTTTGATCAA TTTTCAGACT AGCAAAAAGC ATTTGTAATG CCATGAAGAG
TAGTGCTTAC CATGAGTAAT GAGATCTTTC TAGGTGCATT ATTTTACAGC TTCCAAGGTC ATGCAAATTA CTTTTTGTGG
AGAAACTTTA AACTTAGTTG CACTGTTGTG CGTAAAAACC TCTTTACAAC ATTGTCATGG AAACCTACTA GAATGAACCT
CTTACACTTT ACAGATTGGC AGTTGGAGCA TTATTTATCT GGCACATTTA TTCTTACGTA AGAATGAATC CTCCTAAAAA
TTTTGCACTT GAATGGAGGT TTTCCCCTGT AACTTTATAA CTAGCTCTGG TTGATCAGTT CACTGACTGG GGGACAGTGA
CTAAAATTGA ACTCATTTTA TTGGAAGCTA ATTCCAAAGC TCCCTCACAA ATGTCCACTA CACTATTTAT AGCCAGTTAG
CACTTAGCAG GGTGCCATTG TCCGAACTTT GTAAGCATGT TAGTAAGATC ATTTGATGAT ATAATCGGTT AGGTTGTTTG
CTTCTACACA CCACCATTTC CAATGGTTGT ATAGGCTACG TAGCATGCAT GTAGCATGGT ATTGTATCAA ATACTTGAAT
CGCTGAATTG TGATGCATTT GCTTTGCAGT CTTTGCTGTG TGATCCAAAC CCCAACTCTC CAGCAAACTC AGAAGCTGCC
AGACTGTTTA GTGAGAACAA GCGAGAGTAC AACCGCAAGG TTCGTGAGAT CGTGGAGCAG AGCTGGACAG CTGACTAGGG
CATGCAGCAG GGCAACGGGT GGTATCCACC ATGCCAGAAA GATGCAATAA GCAACCGTGA AAAACCTGTG CGTTTCTGGC
TCTCCAGATT TGCTGTCATC TTAAAACATT ATAAGATCTC CAGTGATTGC TTGTAGTCCG TTGATGTTTT TGTGTTCCCA
TGTCCCAGTT ACTCTTGGCT GCTTTTATGT AGTGGTGTTG ACCTCTCATG CACTAGGGCA TTCTGCTCAT GTAAAAAGGG
GATTATCATC ATAATATGTG AATGGAAGCG AAATGGGTC

Locus: Os07g0166800

Loading...

Locus: Os07g0166800

Loading...