Os07t0166800-02

Locus

Os07g0166800

Description

Rad6 (Ubiquitin carrier protein).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBC7

CGSNL Gene Name

UBIQUITIN-CONJUGATING ENZYME 7

Oryzabase Gene Symbol Synonym(s)

OsUBC7

Oryzabase Gene Name Synonym(s)

Ubiquitin-conjugating enzyme 7

Transcript Evidence

AK070524 (DDBJ, Best hit)

Protein Evidence

C5XAB9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid-amino acid ligase activity (GO:0016881)

Functional domain (InterPro)

Ubiquitin-conjugating enzyme, E2 (IPR000608)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme, active site (IPR023313)

Full-length cDNA

J023055G02 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0166800-02)

RiceXPro (AK070524)

Others

Oryzabase (19555)

KEGG (Os07t0166800-02 (EC:6.3.2.19))

Transcript

4107 bp

>Os07t0166800-02 Rad6 (Ubiquitin carrier protein).
CACGATTCTCTCAGAGAGAGAGAGAGAGAGAGAGAGGGGACTCAGCGAGCGGTGGGCGAG
AGGGGGAGATCGAAACCCTAGCTAGGGTTTGCGCGCGGCGGCGGCGGGGATGTCGACGCC
GGCGAGGAAGCGGCTGATGCGGGACTTCAAGCGGCTGCAGCAGGACCCCCCCGCGGGGAT
CAGCGGCGCGCCGCACGACAACAACATCATGCTCTGGAACGCCGTCATCTTCGGGCCGGA
TGATACGCCGTGGGACGGAGGCACGTTCAAGCTTACCTTGCAGTTTACAGAAGATTATCC
CAACAAGCCGCCGACTGTTCGGTTTGTTTCTAGGATGTTCCACCCAAATATTTATGCAGA
TGGAAGCATCTGCTTGGATATTCTACAGAACCAGTGGAGCCCTATATATGATGTTGCTGC
CATATTGACTTCAATTCAGTCTTTGCTGTGTGATCCAAACCCCAACTCTCCAGCAAACTC
AGAAGCTGCCAGACTGTTTAGTGAGAACAAGCGAGAGTACAACCGCAAGGTTCGTGAGAT
CGTGGAGCAGAGCTGGACAGCTGACTAGGGCATGCAGCAGGGCAACGGGTGGTATCCACC
ATGCCAGAAAGATGCAATAAGCAACCGTGAAAAACCTGTGCGTTTCTGGCTCTCCAGATT
TGCTGTCATCTTAAAACATTATAAGATCTCCAGTGATTGCTTGTAGTCCGTTGATGTTTT
TGTGTTCCCATGTCCCAGTTACTCTTGGCTGCTTTTATGTAGTGGTGTTGACCTCTCATG
CACTAGGGCATTCTGCTCATGTAAAAAGGGGATTATCATCATAATATGTGAATGGAAGCG
AAATGGGTCATGAGATTTGAGTCTGCTTGCACAATGCAGTTTGTCTGCATGATCCTTTTG
CCATGTAGTTTGGCTGTTGGTGCTGTCCTATGCACATGCTTAATATTCTCTGCCGTTTGG
ATTTTTTGCAACATTTTGTATTTTTGTAGGAACAGAAAAAAAAATTCCCGTGATACTTCT
CATGATACAAATGGTACCAAACTGAAATTTATCGTTCCTCGAGTGATGCTTTCGTATGGT
ATAAAGAAGGGTTTTTAggcccctttgaattggaggattgtgaattttggaggatttaat
gtcctaaggattttttcctatgaaacctttgattcataggaaagtataggaaattttctt
taggattgcattcctatagcccaatttcataggaaaataagtaagaggtttaacctcttg
gaaactatcctttgctttgtttgttttctatggtgatattttctgtgttttccattcctg
tagAATTAGGAAAACATGCCACATCAATTCCTACGTCGGGTTTTTAGGCCCCTTTGAAtt
ggaggatttaatgtcctaaggattttttcctatgaaacctttgattcataggaaagtata
ggaaattttctttaggattgcattcctatagcccaatttcataggaaaataagtaagagg
tttaacctcttggaaactatcctttgctttgtttgtttcctatggtgatattttctgtgt
tttccattcctgtagAATTAGGAAAACATGCCACATCAattcctacgtttttcctattcc
tttgtttgtttcctatggtgatattttctgtgttttccattcctgtagaattaggaaaac
atgccacatcaattcctacgtttttactattcctgtgttttttctattctgcgtttcaaa
ggggcccTAGGTAAAGTAGTGCTCTTGATTGGTGTCGGGGGCCTGGGGATATCTCCTTTT
ACTTGTCCATGTAAAGGTCTAAAACAACAAATGCGATACATGGTATTGACACCATTGACA
CAATGATAACCGAAGTGCCCCTACAGAGGACATGCCATAAACGAGGTACTGAACCATGAT
TACATTTAGACCTAGATTCGTAGTGAGACATTTATAGTCCTAGATTCAAAGTGGGAAAAA
TTACAAAATTACAGTTGTGCTTAGCTTCTTACATATTCAAAAGAAACATATAGAAAAGGC
GGTAAAAAAAAAGAAGATAAAAAAAATGTGAAGAAAGTAAAAGAGCCCACTGACTTCTAC
TGGTCTACACCAAGAAGGCCCTATACACATCTTATCTTATAGGGTAGTAGTACACCATAT
GCCAGTTCCAGTCTAGCTTCAGCTGCAGCTGCCATCTGAATTGTTCTCTCATGTTCGGTT
CTTGAAAGATCACACTGCAAAATGTTTGCTTCATGTAATGTTTCCCGCTGAATTGCCGTT
GCTGTTCTTGCCTCAACCTAGAAATCCAAGAAAACACAAGAAAATATCATCTCAGATCAT
AGCTGAATGCATAACATTTCCCTCAACTATCAGCCATGGATGATCAGAGCATGATAGTTC
AGATGCTCAAAGTGCAAGGTTTGGTTTGTTTGGTGATAGATACCTGCAGGCTATGATGGA
GTATCATCTACAGATCTACTGGTCGTCTTCTAAGTCTCTGGGGATCTGCGACGGCGACAG
CGGCGACTCCTCGCTGCTCCGGGAGTCccctctccagtcatcctgcacctgcgcggcgaa
ctgcaggttccacagcacgtcctccaccgacggcctctgcaccgcctccttggccaggca
cctcaggcagatctccatcaccgtcttcaccgactcgtcggagcaccccttgctcaccgc
cgggtccacaaagctcctcctcttcgccgtcccCTCCGCCGTCAGCGCCGATTGCAGCTG
CAGAAAGAACACAGGTGAGTTTCTTTTTTTCTTTTTCAGAACTTTCAGAAGTGGACAGTG
TGATGGTAGTATCTGAAGTCTCATGAAAAATTCAGTTCAGTTTCAGTCTTTGGAGGGAGT
TTGTGTTGCACCTGTTCTTTCATTATCTCCACCTCGTAGATGGATGTGATGGGCCTGCCT
GAGATAACCTCGAGTAGTATCACGCCGAAATCGAAGATGTCGAGCTTATCACCGTTCGGT
ACACTGCGAGAAGAAATTTGCAACAGAAAAGTTCTTAAGAAAACCAGTTGCTTTTAGTAT
AATATACATAGATTCTGCTGTAAGGTGATTTGTCAAGTACCTATCAGATGGATACTTGTT
GCCAGATCCTCCCTGAATTCATCCACAAAAGATGATATAAAACAACAATGTTAGTTCAGA
GTTCAGACAGTGCCAACTCAAAATTCAGCGGTAAGTTTACATGATCAGAGTTTCCTGAAT
CATACCTCGGATTTCATGGTTTCAGATAGGATGGGGATATTGTAGCTGCCTATTTTGGCA
ACAAGATTCTGGTCTAGAAGAATGTTGGTGATCTTCAGATTATTCGCAAATAGGCCAGGT
ATGATCCCTCCATGCAAGAATTGAATTCCTTTGGCAACACCAATGGCTGTTGATATCCTC
TGCACCCAGGTGAGCTTTCTCCCTTCTGTTCCTTCTGAAGTCAAAAGTATCAACAAGTTC
AGTGACATTCAGCTAACCGAGTAACTGATTATTGGAGACCGATTTCAGGAGAAGATGGTA
AACTTACGTGAAATTCTGCCTCTCAGGTTGCCATTCTGAACGTATTCGAAGACGAGATAC
AATTGCGTGATGGTGGAATCGTCGAGATTGTATTCGAAGCAGTGTCCAAGTGCACTGACC
AAGTGCCTGTGCCTGAGCTTGGAGATCATCTCAATGTGGTGATTGAAGCTCTGGGAAGTC
TGGCTCCTCTTCACCTTCAGAGACCTGATTGTCACCGGAGTTCCATTGCTTAGCCTTCCT
CGGTACATCTGACAGTAAAAAAGAGCAAACCATTTTAGACATGGAGCACAACAATTTTAG
TTGCAAACTTGCTATGTTACAACTTGCACATGCCTCAAAAGAAAAGGTGATTCTTGAATA
GATTGAAAAATATGTATGGAAAGATGGCTTTGGTACTCTGACAAGAAAAAAGAGAGAAAG
CTTGTAATAACTATAAAAACTGTTCTCTTTAATCTTTATACCCCAATTGTAATCTAGCAG
TAGTATTTAACTCATTAGAATAATCAGAAAAGTGAATGGGGGCATAAAGCATACTGTCAA
TTAACAAGAACATGAAAAATTAGGTTC

CDS

459 bp

>Os07t0166800-02 Rad6 (Ubiquitin carrier protein).
ATGTCGACGCCGGCGAGGAAGCGGCTGATGCGGGACTTCAAGCGGCTGCAGCAGGACCCC
CCCGCGGGGATCAGCGGCGCGCCGCACGACAACAACATCATGCTCTGGAACGCCGTCATC
TTCGGGCCGGATGATACGCCGTGGGACGGAGGCACGTTCAAGCTTACCTTGCAGTTTACA
GAAGATTATCCCAACAAGCCGCCGACTGTTCGGTTTGTTTCTAGGATGTTCCACCCAAAT
ATTTATGCAGATGGAAGCATCTGCTTGGATATTCTACAGAACCAGTGGAGCCCTATATAT
GATGTTGCTGCCATATTGACTTCAATTCAGTCTTTGCTGTGTGATCCAAACCCCAACTCT
CCAGCAAACTCAGAAGCTGCCAGACTGTTTAGTGAGAACAAGCGAGAGTACAACCGCAAG
GTTCGTGAGATCGTGGAGCAGAGCTGGACAGCTGACTAG

Protein

153 aa

>Os07t0166800-02 Rad6 (Ubiquitin carrier protein).
MSTPARKRLMRDFKRLQQDPPAGISGAPHDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT
EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNS
PANSEAARLFSENKREYNRKVREIVEQSWTAD*

5'UTR

chr07:3593730..3593838 (- strand) : 109 bp

CDS

chr07:3593605..3593729 (- strand) : 125 bp

chr07:3593370..3593395 (- strand) : 26 bp

chr07:3590628..3590717 (- strand) : 90 bp

chr07:3590420..3590508 (- strand) : 89 bp

chr07:3589646..3589774 (- strand) : 129 bp

3'UTR

chr07:3586107..3589645 (- strand) : 3539 bp

FASTA

>Os07t0166800-02 class=Sequence position=chr07:3586107..3593838 (- strand)
CACGATTCTC TCAGAGAGAG AGAGAGAGAG AGAGAGGGGA CTCAGCGAGC GGTGGGCGAG AGGGGGAGAT CGAAACCCTA
GCTAGGGTTT GCGCGCGGCG GCGGCGGGGA TGTCGACGCC GGCGAGGAAG CGGCTGATGC GGGACTTCAA GCGGCTGCAG
CAGGACCCCC CCGCGGGGAT CAGCGGCGCG CCGCACGACA ACAACATCAT GCTCTGGAAC GCCGTCATCT TCGGGTGGGT
GTCAGCCATG GACGCGGAAT TCCCATCTGC CTCTACCTCT CTCCCCCCCT CCCCCTCTCC TGCGCCGGCC CCCCGGTGTT
CTAGGGTTTC GGTGTCCCCG GATCTCGGGG GACCCGAGGT TTTCAGCTGT TTTTTTTTGT TTTTTTGTTG TAGTGGCTGT
GGTGCTAACG AGGAATTGTT TTCCGTGTGA TGATGTTTTG CAGGCCGGAT GATACGCCGT GGGACGGAGG TGAGGCTTGC
TCGGTTTGGT TTTGCTCCGA TCTGTAGCTG GTTTAGTGAT TAGGTTGTGG TTTACTAATT CCTTGGGGAT GGTTCGATGT
GGAAATTGGA ATCGTTAGGA TGGATATAGC ATCATGAGTA TTTTGCCCAG GGAGATGAGA CCGAGTGAGT GGGCAGCTGA
TTCCACATAA ACTTAGAAGG CAGATGAGGA TTGTCTGTTG TTGTCTATGT CGGTCTTGTC GGATATGTGG GGAGATCGAG
CCATGCAATT CTGGAAGGGT CATTACAGGG TTAGGCTATT GGCTAGATGT ATGAATTCCT TAACACGTAA AATTGAAAAC
GACAAAAATA CATGGCATAC TTATGATGCC TGTCACCTAA GCAGCTCTAA TTGAGGTGCG CTGAAACTGT CATTTGGTAA
TTTTGGTTTA TGTGAATTCT ACATGATAAT TGCTAGAGTA GGCATGGTTT CATTAGACTA GTCAACAAAT GAACCTTGCC
ATATCTATCA CATATTCAAT AACAGAAATG CCGATTtagg tcctgttcga atccactgaa agaagtgtat aaacttttgg
gtaaaagtgg cacgcttttc aaattgctaa acggtgcgtt tcgtgcgaaa gctttctata tgaaagttgt tctaaaatat
cagattaatc cattttttca agtttgtaat aattaaaact caattaatcg cactttatta ccacctcatt ttgcgtgaaa
cacttaatcc ttatcttcat cttcatcttc aggagattca aacaccacct taAACATACT CTAGAAATTA GAGTGACTGC
TGCATTTACT GTCTAAAATG GAGTAATAAA GTTGGGAGTT GGTGTGAGCT TGCCTGGGAA GTAGGTTGCA TGTTTGGTTC
AGGAAGGTAG GTTCTACTAT TTGAAATATA TTGTTTTGGA AGTGCATAAC ACATGAAGGA ATAAATAACC TACAAATAAT
TATGGATAGA GTTAACCATG TTGCCATGTG ACACTTATTG TGCATGTTTT GAGCATGTGG TGCCCCGAAT TATCTGTTCG
ACAAATCAGG GCACTGTATA TTTTTTGCTG TTTTGTCTTA ATCAGTTCGC AACGAACTTA ACTATTTGAC TGAATCTGAT
TATGATCTGC ACATATATAA ATTTAAGTTA AGTTATGGTG TCAGATATTT TCCAACAACT AACATTGCCC TTTTTATGGA
AAAGAACTTT CTGTTTTTTT CTCAGAGTTC AGGTCTTCTT CTTTTCCCCT CTTCTATTTG AGTTGCGTAA ACCTCAAGTT
ACGTCTTAGA TATATGATTG ATGATACTAC GGTTCTGTTG CACAAACCAA TTTGTAAGGA TGGATGTTAA ATCCTCTATG
CAAATCTTGG TGCCTGTTTA TTTTATACTG TTTATGTAGG TTTTAGTGTA AGTTGAGCTG TTTAAAAGAT TTACTTTGTT
TTGCTTTTGA GTTTCAGTCT TGTTTTGAAA ATAAAATGAG TACACACTTA TCTTTTAAAT GCATAGCTTA ACTGCATGCC
TACAGTGCAA GAACCCTTAA AATTCTTAGG CCATGATCCT ACCAAAAGAA AAGAGAATGT CATGATGATG TGGTTATGTT
ATGGGCGTAG AAAAAGGATA CTAGTGGGAA TGCTTGGGTT TGCGTCAAAT TTTACTTCAT TTCTTCTCTG TGGTTGTTTA
TTCCAGTGTT GTTGAGGCGG TAATGCAGTT TAAGGCAACC CACCACTGCG AGGCGTAAGG CGTTGCGACG CCCTATGAGA
TGGTTGAGGC ATGATTAATG GAGGATATGG TAGAGAAATT AGGAAGAAAA AAAGGGAAAC CGGTAAAAGG CCCACTAATC
CAGGCAGCCA GCCCACCAAA GCCCAACATA AGTCTTCATA CCTACGTGTT CTATGCCCTA AGAGGCATCT TACTCCACCA
GGCACCAGCT GCCATGATGA GAAGAGGAGT CCCCAGCTGC TGGCCTCATC CACATGACCT CTACTAGGGT TCTAGGATGA
GCTTACCTCT TCTTCTTTCC CTTTCTTTAT TGGTTTTGCT TGTAAGGCCT TTTTCTTTCC CTTTCTTCAC AGTGGACACC
TTGGCCTCTG TGACCGCCTT AGCGCTATAC GCCTTAACAA CCTGGGTTTA TTCTTTAATT CTTCTCATGT GAAATCCTTG
TCTGTAATGT AGTAATGTTG TATGACATAT TATCTTCCCT ACAACTCTAT CTGCATTATG TGATACTGCT GCAGTTCTGT
ACCCCTATAG TCAGGCCATA CAGTTAAATA CTCAGAGCCA GGAGAGCTTG CACTAGCACT ATTATTTTTA TATGATGAAA
GATGTGGTCT TTTGTGTATT GGTTCCTGAT TGTTCTTATC TATCATTGAT CTATTGCTTA TATGACATTT CTTTAGCCTT
TGTTGTTTAA TTTCATTAGT TATAGATAGC CTTGAATCAT CTACAGTACG GCAAAAGTGA TGAATGCAGA TGTTTGGGAA
TTCGGGATTA TGGTTATTAG TAAGACAATA GTTCTGATAC AGGACAACAG ACAACCAAAA GCCACATAAT GATTAATCAT
GCTTCAACTT TTTGTAGCTA CCAGTCTGCC AGCATGGTAA CTTGAGAAGT CGACTAACAG TTAACTCTTA CGTATCTGTA
GGCACGTTCA AGCTTACCTT GCAGTTTACA GAAGATTATC CCAACAAGCC GCCGACTGTT CGGTTTGTTT CTAGGATGTT
CCACCCAAAT AGTAAGCTCT CTTCCCGTGT GATTATATAT TGTTCAATAA TTACCTTACA TTTGTAAACA AATAAAGATC
TTCGTTTTTG AATAATGGAA AACTTATTTA ACATCATACT ATTCATGCAG TTTATGCAGA TGGAAGCATC TGCTTGGATA
TTCTACAGAA CCAGTGGAGC CCTATATATG ATGTTGCTGC CATATTGACT TCAATTCAGG TACCTTTTTG ATCAATTTTC
AGACTAGCAA AAAGCATTTG TAATGCCATG AAGAGTAGTG CTTACCATGA GTAATGAGAT CTTTCTAGGT GCATTATTTT
ACAGCTTCCA AGGTCATGCA AATTACTTTT TGTGGAGAAA CTTTAAACTT AGTTGCACTG TTGTGCGTAA AAACCTCTTT
ACAACATTGT CATGGAAACC TACTAGAATG AACCTCTTAC ACTTTACAGA TTGGCAGTTG GAGCATTATT TATCTGGCAC
ATTTATTCTT ACGTAAGAAT GAATCCTCCT AAAAATTTTG CACTTGAATG GAGGTTTTCC CCTGTAACTT TATAACTAGC
TCTGGTTGAT CAGTTCACTG ACTGGGGGAC AGTGACTAAA ATTGAACTCA TTTTATTGGA AGCTAATTCC AAAGCTCCCT
CACAAATGTC CACTACACTA TTTATAGCCA GTTAGCACTT AGCAGGGTGC CATTGTCCGA ACTTTGTAAG CATGTTAGTA
AGATCATTTG ATGATATAAT CGGTTAGGTT GTTTGCTTCT ACACACCACC ATTTCCAATG GTTGTATAGG CTACGTAGCA
TGCATGTAGC ATGGTATTGT ATCAAATACT TGAATCGCTG AATTGTGATG CATTTGCTTT GCAGTCTTTG CTGTGTGATC
CAAACCCCAA CTCTCCAGCA AACTCAGAAG CTGCCAGACT GTTTAGTGAG AACAAGCGAG AGTACAACCG CAAGGTTCGT
GAGATCGTGG AGCAGAGCTG GACAGCTGAC TAGGGCATGC AGCAGGGCAA CGGGTGGTAT CCACCATGCC AGAAAGATGC
AATAAGCAAC CGTGAAAAAC CTGTGCGTTT CTGGCTCTCC AGATTTGCTG TCATCTTAAA ACATTATAAG ATCTCCAGTG
ATTGCTTGTA GTCCGTTGAT GTTTTTGTGT TCCCATGTCC CAGTTACTCT TGGCTGCTTT TATGTAGTGG TGTTGACCTC
TCATGCACTA GGGCATTCTG CTCATGTAAA AAGGGGATTA TCATCATAAT ATGTGAATGG AAGCGAAATG GGTCATGAGA
TTTGAGTCTG CTTGCACAAT GCAGTTTGTC TGCATGATCC TTTTGCCATG TAGTTTGGCT GTTGGTGCTG TCCTATGCAC
ATGCTTAATA TTCTCTGCCG TTTGGATTTT TTGCAACATT TTGTATTTTT GTAGGAACAG AAAAAAAAAT TCCCGTGATA
CTTCTCATGA TACAAATGGT ACCAAACTGA AATTTATCGT TCCTCGAGTG ATGCTTTCGT ATGGTATAAA GAAGGGTTTT
TAggcccctt tgaattggag gattgtgaat tttggaggat ttaatgtcct aaggattttt tcctatgaaa cctttgattc
ataggaaagt ataggaaatt ttctttagga ttgcattcct atagcccaat ttcataggaa aataagtaag aggtttaacc
tcttggaaac tatcctttgc tttgtttgtt ttctatggtg atattttctg tgttttccat tcctgtagAA TTAGGAAAAC
ATGCCACATC AATTCCTACG TCGGGTTTTT AGGCCCCTTT GAAttggagg atttaatgtc ctaaggattt tttcctatga
aacctttgat tcataggaaa gtataggaaa ttttctttag gattgcattc ctatagccca atttcatagg aaaataagta
agaggtttaa cctcttggaa actatccttt gctttgtttg tttcctatgg tgatattttc tgtgttttcc attcctgtag
AATTAGGAAA ACATGCCACA TCAattccta cgtttttcct attcctttgt ttgtttccta tggtgatatt ttctgtgttt
tccattcctg tagaattagg aaaacatgcc acatcaattc ctacgttttt actattcctg tgttttttct attctgcgtt
tcaaaggggc ccTAGGTAAA GTAGTGCTCT TGATTGGTGT CGGGGGCCTG GGGATATCTC CTTTTACTTG TCCATGTAAA
GGTCTAAAAC AACAAATGCG ATACATGGTA TTGACACCAT TGACACAATG ATAACCGAAG TGCCCCTACA GAGGACATGC
CATAAACGAG GTACTGAACC ATGATTACAT TTAGACCTAG ATTCGTAGTG AGACATTTAT AGTCCTAGAT TCAAAGTGGG
AAAAATTACA AAATTACAGT TGTGCTTAGC TTCTTACATA TTCAAAAGAA ACATATAGAA AAGGCGGTAA AAAAAAAGAA
GATAAAAAAA ATGTGAAGAA AGTAAAAGAG CCCACTGACT TCTACTGGTC TACACCAAGA AGGCCCTATA CACATCTTAT
CTTATAGGGT AGTAGTACAC CATATGCCAG TTCCAGTCTA GCTTCAGCTG CAGCTGCCAT CTGAATTGTT CTCTCATGTT
CGGTTCTTGA AAGATCACAC TGCAAAATGT TTGCTTCATG TAATGTTTCC CGCTGAATTG CCGTTGCTGT TCTTGCCTCA
ACCTAGAAAT CCAAGAAAAC ACAAGAAAAT ATCATCTCAG ATCATAGCTG AATGCATAAC ATTTCCCTCA ACTATCAGCC
ATGGATGATC AGAGCATGAT AGTTCAGATG CTCAAAGTGC AAGGTTTGGT TTGTTTGGTG ATAGATACCT GCAGGCTATG
ATGGAGTATC ATCTACAGAT CTACTGGTCG TCTTCTAAGT CTCTGGGGAT CTGCGACGGC GACAGCGGCG ACTCCTCGCT
GCTCCGGGAG TCccctctcc agtcatcctg cacctgcgcg gcgaactgca ggttccacag cacgtcctcc accgacggcc
tctgcaccgc ctccttggcc aggcacctca ggcagatctc catcaccgtc ttcaccgact cgtcggagca ccccttgctc
accgccgggt ccacaaagct cctcctcttc gccgtcccCT CCGCCGTCAG CGCCGATTGC AGCTGCAGAA AGAACACAGG
TGAGTTTCTT TTTTTCTTTT TCAGAACTTT CAGAAGTGGA CAGTGTGATG GTAGTATCTG AAGTCTCATG AAAAATTCAG
TTCAGTTTCA GTCTTTGGAG GGAGTTTGTG TTGCACCTGT TCTTTCATTA TCTCCACCTC GTAGATGGAT GTGATGGGCC
TGCCTGAGAT AACCTCGAGT AGTATCACGC CGAAATCGAA GATGTCGAGC TTATCACCGT TCGGTACACT GCGAGAAGAA
ATTTGCAACA GAAAAGTTCT TAAGAAAACC AGTTGCTTTT AGTATAATAT ACATAGATTC TGCTGTAAGG TGATTTGTCA
AGTACCTATC AGATGGATAC TTGTTGCCAG ATCCTCCCTG AATTCATCCA CAAAAGATGA TATAAAACAA CAATGTTAGT
TCAGAGTTCA GACAGTGCCA ACTCAAAATT CAGCGGTAAG TTTACATGAT CAGAGTTTCC TGAATCATAC CTCGGATTTC
ATGGTTTCAG ATAGGATGGG GATATTGTAG CTGCCTATTT TGGCAACAAG ATTCTGGTCT AGAAGAATGT TGGTGATCTT
CAGATTATTC GCAAATAGGC CAGGTATGAT CCCTCCATGC AAGAATTGAA TTCCTTTGGC AACACCAATG GCTGTTGATA
TCCTCTGCAC CCAGGTGAGC TTTCTCCCTT CTGTTCCTTC TGAAGTCAAA AGTATCAACA AGTTCAGTGA CATTCAGCTA
ACCGAGTAAC TGATTATTGG AGACCGATTT CAGGAGAAGA TGGTAAACTT ACGTGAAATT CTGCCTCTCA GGTTGCCATT
CTGAACGTAT TCGAAGACGA GATACAATTG CGTGATGGTG GAATCGTCGA GATTGTATTC GAAGCAGTGT CCAAGTGCAC
TGACCAAGTG CCTGTGCCTG AGCTTGGAGA TCATCTCAAT GTGGTGATTG AAGCTCTGGG AAGTCTGGCT CCTCTTCACC
TTCAGAGACC TGATTGTCAC CGGAGTTCCA TTGCTTAGCC TTCCTCGGTA CATCTGACAG TAAAAAAGAG CAAACCATTT
TAGACATGGA GCACAACAAT TTTAGTTGCA AACTTGCTAT GTTACAACTT GCACATGCCT CAAAAGAAAA GGTGATTCTT
GAATAGATTG AAAAATATGT ATGGAAAGAT GGCTTTGGTA CTCTGACAAG AAAAAAGAGA GAAAGCTTGT AATAACTATA
AAAACTGTTC TCTTTAATCT TTATACCCCA ATTGTAATCT AGCAGTAGTA TTTAACTCAT TAGAATAATC AGAAAAGTGA
ATGGGGGCAT AAAGCATACT GTCAATTAAC AAGAACATGA AAAATTAGGT TC

Locus: Os07g0166800

Loading...

Locus: Os07g0166800

Loading...