Os07t0167200-01

Locus

Os07g0167200

Description

Similar to Zinc finger POZ domain protein (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMB10, MB10, OsMB10a, OsMB10b

Oryzabase Gene Name Synonym(s)

MATH-BTB protein 10, MDC protein with a BTB domain 10, MDC protein having BTB domain 10

Transcript Evidence

AK120608 (DDBJ, Best hit)

Protein Evidence

B6TV51 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

BTB/POZ-like (IPR000210)

MATH (IPR002083)

TRAF-like (IPR008974)

BTB/POZ fold (IPR011333)

BTB/POZ (IPR013069)

TRAF-type (IPR013322)

Full-length cDNA

J013151F13 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0167200-01)

RiceXPro (AK120608)

Others

Oryzabase (21204)

KEGG (Os07t0167200-01)

Transcript

1662 bp

>Os07t0167200-01 Similar to Zinc finger POZ domain protein (Fragment).
ACCCGAAGCATCGAACCCGAAACGCTCACCCCAAAATTCCCCATTCCCCAAGCCCTAACC
CTAGCTTTGATCCGACCACCGCTTCCCCTCCCCTCCCATGGACGACGACGCCGGCGACGC
CTCGCCGCCGCCGGCCGCCGCGGGGGTTGGCGCCACCGCCGCCCAGTCGCGGGACATGGC
GGCGTCGCCGACCAGCTCCCGCTCCGTGACGGAGACGGTGAACGGCTCCCACCGCTTCGT
GATCCAGGGCTACTCGCTCGCCAAGGGGATGGGCGTCGGGAAGCACATCGCCAGCGAGAC
CTTCTCCGTCGGCGGCTACCAGTGGGCGGTCTACTTCTACCCCGACGGGAAGAACCCCGA
GGACAACTCCGCCTACGTCTCCGTCTTCATCGCCCTCGCCTCCGAGGGCACCGACGTCCG
CGCCCTCTTCGAGCTCACGCTGCTCGACCAGAGCGGCAAGGGCAAGCACAAGGTCCACTC
CCACTTCGACCGCTCCCTCGAGTCCGGCCCATACACCCTCAAGTACCGCGGCTCCATGTG
gggttacaaaaggttctttcggcgaaccgctcttgagacgtcggactttttgaaagatga
ttgcttgaagataaattgcactgtgggtgttgtggtgtcgactattgattactccagacc
acactctatcctggttccagactctgatataggctatcattttggtacgcttttggacaa
tcatgaaggggtcgatgttgttcttagtgtgggaggagagagatttcatgcacataagtt
ggtgttggctgcacgatctactgtatttagatcaaaatttttcgatgatgaggatgggga
gaagaatgagcctggtgagaatgatgatgtacaagagattgttattgatgatatggaACC
AAAGGTTTTCAAGGCAATGCTTCATTTTATCTACAGAGATACACTTGTTGATGATAACGA
GTTGGGTGGGTCAAGCTCTGAGGGCTCTATCTTCGATACATTGGCAGCGAAGTTGTTGGC
TGCAGCAGACAAGTATGACTTAGCAAGGCTAAGATTGCTATGTGAATCTTACTTGTGCAA
AGCCATTTCTGTGGCTACAGTTGCAAGTACTCTAGCATTGGCTGATCGACACCATGCTAT
GGAGCTTAAAGCTGTTTGCCTAAAGTTTGCTGCAGAAAACCTTTCAGCTGTAATCCGGAC
CGAAGGATTCGATTACCTCAAGGACAACTGCCCATCACTTCAATCCGAGATACTGAGAAC
TCTCGCCGGCTGCGAAGAGGAGTGCAGCAGCGGCGGCAAGAGCCAGAGCGTGTGGGGTCA
GCTCTCGGATGGTGGTGACACGAGTGGCCGTAGGGTTAGGCCAAGAACCTAAAAGACCCA
CCACATAACACTGACCTTGTTTAGCGAGCACCTGTGTAAATGGCGACATCAATATCATCT
GTATGTGACAAAGATGAGATCTGATAGTTGACTTGGACTTCATCTCATCACGCTCTTTTT
GCATCGTAATTGCTATGCTGTTTATAAGTTTAGCTGATTGTATTTGATCCTGTGACCCGT
TGCTGCTGTGCGGACGCTTCCATAAACTCACTACAAAATGGTGATTTTTTGGGACTTGTT
CGAATCAGCTTTCTTCTGCTAGTAACAGATTTGTTTTAGCTC

CDS

1275 bp

>Os07t0167200-01 Similar to Zinc finger POZ domain protein (Fragment).
ATGGACGACGACGCCGGCGACGCCTCGCCGCCGCCGGCCGCCGCGGGGGTTGGCGCCACC
GCCGCCCAGTCGCGGGACATGGCGGCGTCGCCGACCAGCTCCCGCTCCGTGACGGAGACG
GTGAACGGCTCCCACCGCTTCGTGATCCAGGGCTACTCGCTCGCCAAGGGGATGGGCGTC
GGGAAGCACATCGCCAGCGAGACCTTCTCCGTCGGCGGCTACCAGTGGGCGGTCTACTTC
TACCCCGACGGGAAGAACCCCGAGGACAACTCCGCCTACGTCTCCGTCTTCATCGCCCTC
GCCTCCGAGGGCACCGACGTCCGCGCCCTCTTCGAGCTCACGCTGCTCGACCAGAGCGGC
AAGGGCAAGCACAAGGTCCACTCCCACTTCGACCGCTCCCTCGAGTCCGGCCCATACACC
CTCAAGTACCGCGGCTCCATGTGgggttacaaaaggttctttcggcgaaccgctcttgag
acgtcggactttttgaaagatgattgcttgaagataaattgcactgtgggtgttgtggtg
tcgactattgattactccagaccacactctatcctggttccagactctgatataggctat
cattttggtacgcttttggacaatcatgaaggggtcgatgttgttcttagtgtgggagga
gagagatttcatgcacataagttggtgttggctgcacgatctactgtatttagatcaaaa
tttttcgatgatgaggatggggagaagaatgagcctggtgagaatgatgatgtacaagag
attgttattgatgatatggaACCAAAGGTTTTCAAGGCAATGCTTCATTTTATCTACAGA
GATACACTTGTTGATGATAACGAGTTGGGTGGGTCAAGCTCTGAGGGCTCTATCTTCGAT
ACATTGGCAGCGAAGTTGTTGGCTGCAGCAGACAAGTATGACTTAGCAAGGCTAAGATTG
CTATGTGAATCTTACTTGTGCAAAGCCATTTCTGTGGCTACAGTTGCAAGTACTCTAGCA
TTGGCTGATCGACACCATGCTATGGAGCTTAAAGCTGTTTGCCTAAAGTTTGCTGCAGAA
AACCTTTCAGCTGTAATCCGGACCGAAGGATTCGATTACCTCAAGGACAACTGCCCATCA
CTTCAATCCGAGATACTGAGAACTCTCGCCGGCTGCGAAGAGGAGTGCAGCAGCGGCGGC
AAGAGCCAGAGCGTGTGGGGTCAGCTCTCGGATGGTGGTGACACGAGTGGCCGTAGGGTT
AGGCCAAGAACCTAA

Protein

425 aa

>Os07t0167200-01 Similar to Zinc finger POZ domain protein (Fragment).
MDDDAGDASPPPAAAGVGATAAQSRDMAASPTSSRSVTETVNGSHRFVIQGYSLAKGMGV
GKHIASETFSVGGYQWAVYFYPDGKNPEDNSAYVSVFIALASEGTDVRALFELTLLDQSG
KGKHKVHSHFDRSLESGPYTLKYRGSMWGYKRFFRRTALETSDFLKDDCLKINCTVGVVV
STIDYSRPHSILVPDSDIGYHFGTLLDNHEGVDVVLSVGGERFHAHKLVLAARSTVFRSK
FFDDEDGEKNEPGENDDVQEIVIDDMEPKVFKAMLHFIYRDTLVDDNELGGSSSEGSIFD
TLAAKLLAAADKYDLARLRLLCESYLCKAISVATVASTLALADRHHAMELKAVCLKFAAE
NLSAVIRTEGFDYLKDNCPSLQSEILRTLAGCEEECSSGGKSQSVWGQLSDGGDTSGRRV
RPRT*

5'UTR

chr07:3614307..3614403 (- strand) : 97 bp

CDS

chr07:3613864..3614306 (- strand) : 443 bp

chr07:3612494..3612866 (- strand) : 373 bp

chr07:3612130..3612403 (- strand) : 274 bp

chr07:3611142..3611326 (- strand) : 185 bp

3'UTR

chr07:3610852..3611141 (- strand) : 290 bp

FASTA

>Os07t0167200-01 class=Sequence position=chr07:3610852..3614403 (- strand)
ACCCGAAGCA TCGAACCCGA AACGCTCACC CCAAAATTCC CCATTCCCCA AGCCCTAACC CTAGCTTTGA TCCGACCACC
GCTTCCCCTC CCCTCCCATG GACGACGACG CCGGCGACGC CTCGCCGCCG CCGGCCGCCG CGGGGGTTGG CGCCACCGCC
GCCCAGTCGC GGGACATGGC GGCGTCGCCG ACCAGCTCCC GCTCCGTGAC GGAGACGGTG AACGGCTCCC ACCGCTTCGT
GATCCAGGGC TACTCGCTCG CCAAGGGGAT GGGCGTCGGG AAGCACATCG CCAGCGAGAC CTTCTCCGTC GGCGGCTACC
AGTGGGCGGT CTACTTCTAC CCCGACGGGA AGAACCCCGA GGACAACTCC GCCTACGTCT CCGTCTTCAT CGCCCTCGCC
TCCGAGGGCA CCGACGTCCG CGCCCTCTTC GAGCTCACGC TGCTCGACCA GAGCGGCAAG GGCAAGCACA AGGTCCACTC
CCACTTCGAC CGCTCCCTCG AGTCCGGCCC ATACACCCTC AAGTACCGCG GCTCCATGTG GTAAGCAAAT CTTCTGCCTC
GATTTGGATT CGGTCGTGAG GTTGGTGAGT TGCGTTTTAT CCATTCGAAT GTCTAGTTTG GATCGGTTAG TGCTGAATTG
CGGATCGATG TTGGTAGCCA ATGTGCTATG TGTGATTCAG TTGTGATTGT CCTGCAATGG CGATTTGAGT ATTGGCATTA
TAGTTTTCAT GAGATTATTG AGGTTCATTC ATGTGAATAC CATCATATCA TATATAATAC TTGGCATTTG CAGCTTTACA
TTTTTAGCAG CTCAGAATAC CAATATATGT TTCTACAATT ATTTGAGTTG GGAGGTGTTA GTGCCCTTGC AATAGTTTGT
TGTATGCCAT ACAGCTTATA TAGTCACTTT TTTAGCGGAG TTGATGCAAC CATCAGAACT GCATAATAGA ATTTATAGCC
CTTGTGTTTC AGAAGAAGGA ATCTTAAACC TTGTCTTGAA ACTGTCACCT TCTTATGCTT TATATTCATT GGTTAGGATA
AGTTTCCTTC TTCTATTGGA CTGGCCAGTA GCCACCCCTA AAAATATTTC ATACTGCCAA CATGCAATTT GTGATTTGGT
TTTGCCGAAT TCATGCAACC ACTGTGTTGT TTGATTTACC TGGCTTTCAT GCTTTGGGAT TGCTTCATTG GAACATTATG
CATTAGCTAC TGTCAAGGGA TTTTGGAATG GTTTTAAACT TTTAATGCAA TCTGTTGTCA GCGATTTTTT TTGAACTGTT
TTGTTAGTTT AGATGCGTAC CAATAGCTTA TTGTTGTTTC AGATTCGTAC ATTTGAATCT AACTGAAGTG ACAGATACCA
TTTTACTGAA ATACGGAAGG TGAGACTCCT ATTCTGTACT GGTATGTTAG ATATAAATGG CAAAGACTTC TATCTGACAA
TCGATATGCT TAATGAGTGT CCATTCTTGT GTTTTGAAAT ATACAGTTAA CTATCTTATC AGtttctgat aatcaatttt
attctccttt ctttcagggg ttacaaaagg ttctttcggc gaaccgctct tgagacgtcg gactttttga aagatgattg
cttgaagata aattgcactg tgggtgttgt ggtgtcgact attgattact ccagaccaca ctctatcctg gttccagact
ctgatatagg ctatcatttt ggtacgcttt tggacaatca tgaaggggtc gatgttgttc ttagtgtggg aggagagaga
tttcatgcac ataagttggt gttggctgca cgatctactg tatttagatc aaaatttttc gatgatgagg atggggagaa
gaatgagcct ggtgagaatg atgatgtaca agagattgtt attgatgata tggaACCAAA GGTTTTCAAG GTTTGTTCCA
GCTTCTTATT TTGAATTTAT TTTATCCTTG TAGCTTTAGA AGTTCAGAAT AAGCACTTAC TAATGCGAAT TTCTTTGCAG
GCAATGCTTC ATTTTATCTA CAGAGATACA CTTGTTGATG ATAACGAGTT GGGTGGGTCA AGCTCTGAGG GCTCTATCTT
CGATACATTG GCAGCGAAGT TGTTGGCTGC AGCAGACAAG TATGACTTAG CAAGGCTAAG ATTGCTATGT GAATCTTACT
TGTGCAAAGC CATTTCTGTG GCTACAGTTG CAAGTACTCT AGCATTGGCT GATCGACACC ATGCTATGGA GCTTAAAGCT
GTTTGCCTAA AGTTTGCTGC AGAAAACCTT TCAGGTGTGT ACCTTACATT CACATCAATT CTGGTTTGCA TTCATTGCGT
CCTATGGGCC CAATTTTGGC CCTATTTTAT GTCAATCAAA ATGCTTCAGC ATGGAGCTGT GAATCTGCAA AATATCTTGA
TTTGGTTCAA TAAATAAATT TTAGCCCTGT GTGCCCAGTG TGTTCATTTG TTTGGTCATG TTGCCATGGG AAAAGTTCCT
TGTACTCATC ATTAAAACTT AACAATTGTT CGTTGTAGAC GCATCCATGC TTTCAGTATC TGAACCAATA ACAAATTCTT
TAGACCAGCA CAGTTTCATG TTGTCAGGTT TGATTTTTTT TCTTCGGCAG CTTACAGCAT GTTAAAAATG TGCACTGGCT
GCAAATTTCT TTTAAAGCTC TCAAAAATTA AATGGGAAGT AGCATGTGCA TACTTCTGGT ATCTTGTTGC ATTTGTTCTA
TTGGTGATAC AGAACAGAAT ACCTGAAACG TGTTAAGGAA GAAGCGATTA TAAAACTATT TATGTTCTTA AACTGGACTG
GTACAGCTTG CTAGATAAAT AGTGGTTAAG TTTGCAAGTG GAGAATAATA TTATGAGATG AGCGGCATTT ACTTTTTGGT
CAGAATTTTA GCTCTGTTAA AATTCCATTA ACATATACAA TTTAATTATT TCAGTAATTT CATATTTTAA CCATTGTGCC
TGGAAAATTA TTGCTTCCAC GTGTCATCGA TTGAAATCTT TACCTTTTGG TTGCTTTCTG GATGCAATTA TGTTTATACG
GTTTCATAAC ATTCCAGATA CCCTTATGTC TCTGCAGCTG TAATCCGGAC CGAAGGATTC GATTACCTCA AGGACAACTG
CCCATCACTT CAATCCGAGA TACTGAGAAC TCTCGCCGGC TGCGAAGAGG AGTGCAGCAG CGGCGGCAAG AGCCAGAGCG
TGTGGGGTCA GCTCTCGGAT GGTGGTGACA CGAGTGGCCG TAGGGTTAGG CCAAGAACCT AAAAGACCCA CCACATAACA
CTGACCTTGT TTAGCGAGCA CCTGTGTAAA TGGCGACATC AATATCATCT GTATGTGACA AAGATGAGAT CTGATAGTTG
ACTTGGACTT CATCTCATCA CGCTCTTTTT GCATCGTAAT TGCTATGCTG TTTATAAGTT TAGCTGATTG TATTTGATCC
TGTGACCCGT TGCTGCTGTG CGGACGCTTC CATAAACTCA CTACAAAATG GTGATTTTTT GGGACTTGTT CGAATCAGCT
TTCTTCTGCT AGTAACAGAT TTGTTTTAGC TC

Locus: Os07g0167200

Loading...

Locus: Os07g0167200

Loading...