Os07t0168800-01

Locus

Os07g0168800

Description

A20/AN1-type zinc finger protein, Response to various abiotic stresses, Temperature stress tolerance

RAP-DB Gene Symbol Synonym(s)

ZFP177

RAP-DB Gene Name Synonym(s)

ZINC FINGER PROTEIN 177

CGSNL Gene Symbol

ZFP177

CGSNL Gene Name

ZINC FINGER PROTEIN 177

Oryzabase Gene Symbol Synonym(s)

OsSAP9, SAP9, ZFP33

Oryzabase Gene Name Synonym(s)

Zinc finger A20 and AN1 domain-containing stress-associated protein 9, stress associated protein 9

Transcript Evidence

AK121813

Protein Evidence

Q7Y1W9

Literature

PMID: 18588956

Note

Manual Curation

January 22, 2021

Gene Ontology (GO)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

AN1-like Zinc finger (IPR035896)

Zinc finger, A20-type (IPR002653)

Zinc finger, AN1-type (IPR000058)

Experimentally confirmed subcellular location

cytoplasm (GO:0005737)

Full-length cDNA

J033098F24 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0168800-01)

RiceXPro (AK121813)

Others

Oryzabase (8371)

KEGG (Os07t0168800-01)

Transcript

888 bp

>Os07t0168800-01 A20/AN1-type zinc finger protein, Response to various abiotic stresses, Temperature stress tolerance
GTCGTCGTCCTCCTCCACCTTCCCCTCCCTCAGCCTCGTCGTCGTCCCCCCCAAAAAAAC
GCGAAGAGAGAGAGAAAGCGAGATAGAGAGAGAGAGAGAGAATCCTCCGGTGAGGAAAAG
TCCCGTGCCCTTCTCGCCTCGCAGCCTGCCGGTAGCAATGGCACAAGAAAGCTGGAAAAA
TGAGTCTGAGGAGACTGTCCACACACCGGAGGCCCCAATATTGTGTGTAAACAACTGTGG
CTTCTTCGGCAGTAGCATGACGAACAATATGTGTTCGAAGTGCTACAGGGACTTTGTGAA
GGTCACGACAATGGCTGCCCCAGTAGTGGAGAAGAAGGCATTTACGCCAGCATCGTCTTC
GAAGACACCATTGGAGCCAGCAAAGCCAGATGAAGTTCCTGCCGCAGCTGTAGAGGATAA
GCAAGCGGCACAGGAGCCTCCAAAGCCACCCAGCAACCGATGCCTGTCATGCCGTAAGAA
GGTTGGTCTGACTGGCTTCCAGTGCCGATGCGGAGGTACCTTCTGCTCAACACACCGTTA
TACCGAAGCTCACGACTGCACCTTCGACTACAAGAAGGCCGGCCGGGATCAGATTGCCAA
GCAGAATCCTGTTGTGATAGCCGAGAAGATCAACAAGATCTGATTGAAGGTTATGGAAGG
GCCATTTAATCTCTATTCATGGTGGCAACCGAGTCTTCAAGTTTACTTCAGCCAGTAGGT
TCCTTCAGGTCTGGGTTAGTGTGCTAGGAGTCCCAATTGTGTCTATCCTTCCTCCTTATC
ATGGTTTCATTCTCTGGCAATTAAGGAATAATAATGTAAATATATATTATATTCTTAACT
ATATTTCCATCTTATTGCTTATTGTTACAGCCTTGATGCTCTATTTTC

CDS

486 bp

>Os07t0168800-01 A20/AN1-type zinc finger protein, Response to various abiotic stresses, Temperature stress tolerance
ATGGCACAAGAAAGCTGGAAAAATGAGTCTGAGGAGACTGTCCACACACCGGAGGCCCCA
ATATTGTGTGTAAACAACTGTGGCTTCTTCGGCAGTAGCATGACGAACAATATGTGTTCG
AAGTGCTACAGGGACTTTGTGAAGGTCACGACAATGGCTGCCCCAGTAGTGGAGAAGAAG
GCATTTACGCCAGCATCGTCTTCGAAGACACCATTGGAGCCAGCAAAGCCAGATGAAGTT
CCTGCCGCAGCTGTAGAGGATAAGCAAGCGGCACAGGAGCCTCCAAAGCCACCCAGCAAC
CGATGCCTGTCATGCCGTAAGAAGGTTGGTCTGACTGGCTTCCAGTGCCGATGCGGAGGT
ACCTTCTGCTCAACACACCGTTATACCGAAGCTCACGACTGCACCTTCGACTACAAGAAG
GCCGGCCGGGATCAGATTGCCAAGCAGAATCCTGTTGTGATAGCCGAGAAGATCAACAAG
ATCTGA

Protein

162 aa

>Os07t0168800-01 A20/AN1-type zinc finger protein, Response to various abiotic stresses, Temperature stress tolerance
MAQESWKNESEETVHTPEAPILCVNNCGFFGSSMTNNMCSKCYRDFVKVTTMAAPVVEKK
AFTPASSSKTPLEPAKPDEVPAAAVEDKQAAQEPPKPPSNRCLSCRKKVGLTGFQCRCGG
TFCSTHRYTEAHDCTFDYKKAGRDQIAKQNPVVIAEKINKI*

5'UTR

chr07:3678263..3678406 (- strand) : 144 bp

chr07:3676713..3676725 (- strand) : 13 bp

CDS

chr07:3676227..3676712 (- strand) : 486 bp

3'UTR

chr07:3675982..3676226 (- strand) : 245 bp

FASTA

>Os07t0168800-01 class=Sequence position=chr07:3675982..3678406 (- strand)
GTCGTCGTCC TCCTCCACCT TCCCCTCCCT CAGCCTCGTC GTCGTCCCCC CCAAAAAAAC GCGAAGAGAG AGAGAAAGCG
AGATAGAGAG AGAGAGAGAG AATCCTCCGG TGAGGAAAAG TCCCGTGCCC TTCTCGCCTC GCAGGTTGGT GCGCCCCTCT
CCTCGTTCAT CTTCTTCCCC CAGATCCGAT CGGCGGTGGC GGTGGCGGTG GCGGTGGCCG ATCTGAGCCA TCCGCCACCG
CGGGTTCGTC GGGTGGTTGG CTTGATTTTT TTTATTTTTT TGGGGGTTTT TTTGGGGGGA GGGGGTTATT GGGAGATCGG
GATGGGTGTG GTTGGATCTG TGATTGTTGT TGTTGTTGTT GATAGGGGTT GCTTGCTTGC GATTTGATTG TGTGTTCGGA
GGTTGACCTT ATGGTTATCG ATTTTGCTGT GATTTGATTG CTTCCAAATT TGCTGCGATT TGATTTGATT CTAAGATGTA
GTCATGTAGG GGAGATGATT TTTTTTTTTT TACTTTTTGA GCCAATCAGC ATAGGGAGGA GTGGGAGACA TAGAATTCTC
TCGCTTATGA GGAAAATTGG ATGTGGCATG TTGCTCCCAG CCTTATCTCA ATCGTGTGAA CCTCCATGAG AGGTGAGGGA
AGCTACGCCA ACGATTGATA CACGGTTTCT GTGTGCTTTG CCTTTGCGCG GAGATTGATA AAGGATTAAA GGGATCAACC
TTTCTTGCCG TGCATGGCAA ATCAGCGATT GATTATATTC TGGGGGGATA GCGCCATGGG ATTTCTTGAT AAGCCTGTAA
AAAAAAAAAA GAAGAAAAGG TCAGCCGCCT TTTGGATATT AGGGATTGCG GGAAGCTAGA GAGAGGTTTC TTGGATTGTA
GGCACATCCG GATGGGATGA ATTGAGGACG TAGGTTGCTT CCGCGGTTTG CATAAGTTAT CGTGGAGTGA ACAATCCAGC
AAAGTCTATG ATTTGTCTGA GGCTGTGAGC AATATAGATG GACGAACGAT GAGGTAGAAG AACATTGGTT CTGCCTAATG
ATCTGCTCAT ATAGCAGAAC GATTGTAGCG CGGAGTTTCA GGTATTTCGT CACTGCTGAT TTTGCTCTGC AGGAATCAAA
AGCAGAGAAG ACCGTTGGTT TCTATGTGTT TCCCATTGTA GTGTTTTAAG AATTGCTCAG CTTTTGGAGG GATACTACTA
TAATACTAGG ACATAGCCTC TCGGGAGAAT CATATAACCT GCTGTTTTTC AATGTTTGAA ATCGGCTACC TAACATTGCC
ATCTCCATCT GCTTGCGAAC ACAATCCTTA GCTGTATGAA ATTATGAAAT TTTATCAATT CCCTGGTTTG ATGGTCTCTT
GAATTTGGTT GGCTAGAACA ATATTTATTA GAATTTTGTT AACCTGGGAT GTATCCAGTG ACACATTTGG CTGTCCTACT
GCGCAATGCT GATACATGCT ATATCTTTTG CAAATTAATT TGAGAGCTGA AACAATAAAA AACAGATTAT ATCACCTAAT
TAAATGAAAC TGAAAATGGT ACAGATCCTT TTCATGATAC CGATCCCTAG TTCCCCCACC CATTTGCAGC CTGTTTTCTT
GCATATGGTG TTTTACTTAT TTCCTATTCT AAAAATGTAA TTTTCATCCA CATTTACTCA TAATTTGTTT TGCACGTACA
GCCTGCCGGT AGCAATGGCA CAAGAAAGCT GGAAAAATGA GTCTGAGGAG ACTGTCCACA CACCGGAGGC CCCAATATTG
TGTGTAAACA ACTGTGGCTT CTTCGGCAGT AGCATGACGA ACAATATGTG TTCGAAGTGC TACAGGGACT TTGTGAAGGT
CACGACAATG GCTGCCCCAG TAGTGGAGAA GAAGGCATTT ACGCCAGCAT CGTCTTCGAA GACACCATTG GAGCCAGCAA
AGCCAGATGA AGTTCCTGCC GCAGCTGTAG AGGATAAGCA AGCGGCACAG GAGCCTCCAA AGCCACCCAG CAACCGATGC
CTGTCATGCC GTAAGAAGGT TGGTCTGACT GGCTTCCAGT GCCGATGCGG AGGTACCTTC TGCTCAACAC ACCGTTATAC
CGAAGCTCAC GACTGCACCT TCGACTACAA GAAGGCCGGC CGGGATCAGA TTGCCAAGCA GAATCCTGTT GTGATAGCCG
AGAAGATCAA CAAGATCTGA TTGAAGGTTA TGGAAGGGCC ATTTAATCTC TATTCATGGT GGCAACCGAG TCTTCAAGTT
TACTTCAGCC AGTAGGTTCC TTCAGGTCTG GGTTAGTGTG CTAGGAGTCC CAATTGTGTC TATCCTTCCT CCTTATCATG
GTTTCATTCT CTGGCAATTA AGGAATAATA ATGTAAATAT ATATTATATT CTTAACTATA TTTCCATCTT ATTGCTTATT
GTTACAGCCT TGATGCTCTA TTTTC

Locus: Os07g0168800

Loading...

Locus: Os07g0168800

Loading...