Os07t0174400-00

Locus

Os07g0174400

Description

Similar to Non-specific lipid-transfer protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLLA6, OsLTPG14, OsLTPg14, LLA6, LTPG14, LTPg14

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein-like AGP 6, non-specific lipid transfer protein-like arabinogalactan protein 6, GPI-anchored non-specific lipid transfer protein 14, type G nsLTP 14, type G non-specific lipid transfer protein 14

Transcript Evidence

ab initio prediction

Protein Evidence

A2YIM6 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Molecular Function: lipid binding (GO:0008289)

Functional domain (InterPro)

Plant lipid transfer protein/Par allergen (IPR000528)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Expression Databases

TENOR (Os07t0174400-00)

Others

Oryzabase (11333)

Transcript

396 bp

>Os07t0174400-00 Similar to Non-specific lipid-transfer protein.
ATGGCGGTCGCGAGAGGAGTTGCACTGGCCGTCGTGCTCGCCGCGGCGGCGGCGATCCTC
GCGGCGAGCCCCGTCGCGGCGCAGGGCGGCGGCGGCGGCGGCGGCAGCGGCAGCTGCATG
ACGGAGATAATCAGCCTGGCGTCGTGCCTGGGCTACATGTCCGGGAACTCGTCGGCGCCG
AAGCCGTCGTGCTGCACGGCGCTGTCGAGCGTGGTGACGTCCAAACCGGCGTGCCTCTGC
GCCGTGCTCGGCGGCGGCGCCTCCTCGCTCGGCGTCACCATCAACAACACCCGCGCCCTC
GAGCTCCCCGCCGCCTGCAACGTCAAGACCCCTCCGGCGAGCCAGTGCAGCAGTAAGTCG
ATCTCCTTCCATTCTTCCGGCGAATCGCAGCCGTGA

CDS

396 bp

>Os07t0174400-00 Similar to Non-specific lipid-transfer protein.
ATGGCGGTCGCGAGAGGAGTTGCACTGGCCGTCGTGCTCGCCGCGGCGGCGGCGATCCTC
GCGGCGAGCCCCGTCGCGGCGCAGGGCGGCGGCGGCGGCGGCGGCAGCGGCAGCTGCATG
ACGGAGATAATCAGCCTGGCGTCGTGCCTGGGCTACATGTCCGGGAACTCGTCGGCGCCG
AAGCCGTCGTGCTGCACGGCGCTGTCGAGCGTGGTGACGTCCAAACCGGCGTGCCTCTGC
GCCGTGCTCGGCGGCGGCGCCTCCTCGCTCGGCGTCACCATCAACAACACCCGCGCCCTC
GAGCTCCCCGCCGCCTGCAACGTCAAGACCCCTCCGGCGAGCCAGTGCAGCAGTAAGTCG
ATCTCCTTCCATTCTTCCGGCGAATCGCAGCCGTGA

Protein

132 aa

>Os07t0174400-00 Similar to Non-specific lipid-transfer protein.
MAVARGVALAVVLAAAAAILAASPVAAQGGGGGGGSGSCMTEIISLASCLGYMSGNSSAP
KPSCCTALSSVVTSKPACLCAVLGGGASSLGVTINNTRALELPAACNVKTPPASQCSSKS
ISFHSSGESQP*

CDS

chr07:3910661..3911056 (+ strand) : 396 bp

FASTA

>Os07t0174400-00 class=Sequence position=chr07:3910661..3911056 (+ strand)
ATGGCGGTCG CGAGAGGAGT TGCACTGGCC GTCGTGCTCG CCGCGGCGGC GGCGATCCTC GCGGCGAGCC CCGTCGCGGC
GCAGGGCGGC GGCGGCGGCG GCGGCAGCGG CAGCTGCATG ACGGAGATAA TCAGCCTGGC GTCGTGCCTG GGCTACATGT
CCGGGAACTC GTCGGCGCCG AAGCCGTCGT GCTGCACGGC GCTGTCGAGC GTGGTGACGT CCAAACCGGC GTGCCTCTGC
GCCGTGCTCG GCGGCGGCGC CTCCTCGCTC GGCGTCACCA TCAACAACAC CCGCGCCCTC GAGCTCCCCG CCGCCTGCAA
CGTCAAGACC CCTCCGGCGA GCCAGTGCAG CAGTAAGTCG ATCTCCTTCC ATTCTTCCGG CGAATCGCAG CCGTGA

Locus: Os07g0174400

Loading...

Locus: Os07g0174400

Loading...