Os07t0179200-01

Locus

Os07g0179200

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP63

CGSNL Gene Name

CYCLOPHILIN 63

Oryzabase Gene Symbol Synonym(s)

OsCYP63, OsCYP-18

Oryzabase Gene Name Synonym(s)

cyclophilin 63, cyclophilin 18

Transcript Evidence

AK059946 (DDBJ, Best hit)

Protein Evidence

B9FVT7 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

006-210-G10 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0179200-01)

Others

Oryzabase (10075)

Transcript

1050 bp

>Os07t0179200-01 Conserved hypothetical protein.
TGGAAGATGCAGATAAAGGCAAACAAACAGCTACCCTTGACAACATATCAAATGAAGGAA
GCAAACCCTCAAACACAGATGGAAATGGGGCTGGTATCAGGGATGATCCTGGTGCGAGAG
CTAGGAGCAGTCCTATTAGGGCTGATGCAAGTTTAACAAAAGTGGATGGCAACAATGGTG
CTGATACTGCAGAGGCTGGTATATCTAGAGCTGAACCTGTGCCAACCAATGGTAAAGATT
TAGCAATGGGCTCTACAGACAACGGACAGCCTCAACGTGTCAGGAAGGGGCGTGGTTTTA
CTCAACAATATGCATTTGCACGTCGATACAGGACACCATCTCCAGAGCGTTCCCCTGTTC
GGTCTCGCTACAATGATGGAAGAAATGATAGGTGGAATCATTTTAATAGGTATGGAAGAA
ATGGTCCCTACGGTGCACGCTCACCAGTAAGAAGATATCGTGGTTCCCCAAGAGCCAGTA
GTCCGTCCAGATACCCAAGGAGAGACCGTAGCAGGAGCAGGTCACGCAGTCCATTGAGGT
ACCGTGAGCGTGGAGGATATCGCCGCCCCAGTCCAAGGCACAGCCGCAGCCGCAGCCCAG
CGGAGCACCAGAGGCGAGATGTAAGAAACAGGCTTCGATCAGGTCGGGATGGTGGTGGCC
CTGATCACCGTAATAGCAGCCCTCCTGTCAATAGAGGAAGGTCAAGATCCAGGTCGAAGA
GCCGTGATCCCTCGAAGTCCAGATCACCAGATGCTCCTGCCAAAAAGGGGAGCTCAAAAT
ATAACCGCAGGCGCAGCAGCAGTTCAAGATCCAGTAGCCCTGCTGGAAGTAAAGGCTTGG
TTTCATACTGAGATGTGATATCAGAAGTTGAGGTGATATCAGGAGTTGAAAACCCTATGT
TCCATGGTAGCTTGGTATTGAGTACTACCCTTTAAGAATGATGATGTAGTTAATGGCTTA
ATGTACTCTTCTTTTGTAACGTTTCTCATTCAGAGATTGTTGTTTTTATGCATCTTCTAT
TTGGATATGATATTTAGACTTCTAAGTTCT

CDS

849 bp

>Os07t0179200-01 Conserved hypothetical protein.
GAAGATGCAGATAAAGGCAAACAAACAGCTACCCTTGACAACATATCAAATGAAGGAAGC
AAACCCTCAAACACAGATGGAAATGGGGCTGGTATCAGGGATGATCCTGGTGCGAGAGCT
AGGAGCAGTCCTATTAGGGCTGATGCAAGTTTAACAAAAGTGGATGGCAACAATGGTGCT
GATACTGCAGAGGCTGGTATATCTAGAGCTGAACCTGTGCCAACCAATGGTAAAGATTTA
GCAATGGGCTCTACAGACAACGGACAGCCTCAACGTGTCAGGAAGGGGCGTGGTTTTACT
CAACAATATGCATTTGCACGTCGATACAGGACACCATCTCCAGAGCGTTCCCCTGTTCGG
TCTCGCTACAATGATGGAAGAAATGATAGGTGGAATCATTTTAATAGGTATGGAAGAAAT
GGTCCCTACGGTGCACGCTCACCAGTAAGAAGATATCGTGGTTCCCCAAGAGCCAGTAGT
CCGTCCAGATACCCAAGGAGAGACCGTAGCAGGAGCAGGTCACGCAGTCCATTGAGGTAC
CGTGAGCGTGGAGGATATCGCCGCCCCAGTCCAAGGCACAGCCGCAGCCGCAGCCCAGCG
GAGCACCAGAGGCGAGATGTAAGAAACAGGCTTCGATCAGGTCGGGATGGTGGTGGCCCT
GATCACCGTAATAGCAGCCCTCCTGTCAATAGAGGAAGGTCAAGATCCAGGTCGAAGAGC
CGTGATCCCTCGAAGTCCAGATCACCAGATGCTCCTGCCAAAAAGGGGAGCTCAAAATAT
AACCGCAGGCGCAGCAGCAGTTCAAGATCCAGTAGCCCTGCTGGAAGTAAAGGCTTGGTT
TCATACTGA

Protein

283 aa

>Os07t0179200-01 Conserved hypothetical protein.
EDADKGKQTATLDNISNEGSKPSNTDGNGAGIRDDPGARARSSPIRADASLTKVDGNNGA
DTAEAGISRAEPVPTNGKDLAMGSTDNGQPQRVRKGRGFTQQYAFARRYRTPSPERSPVR
SRYNDGRNDRWNHFNRYGRNGPYGARSPVRRYRGSPRASSPSRYPRRDRSRSRSRSPLRY
RERGGYRRPSPRHSRSRSPAEHQRRDVRNRLRSGRDGGGPDHRNSSPPVNRGRSRSRSKS
RDPSKSRSPDAPAKKGSSKYNRRRSSSSRSSSPAGSKGLVSY*

5'UTR

chr07:4179287..4179288 (+ strand) : 2 bp

CDS

chr07:4179289..4179386 (+ strand) : 98 bp

chr07:4179799..4180107 (+ strand) : 309 bp

chr07:4180188..4180268 (+ strand) : 81 bp

chr07:4180837..4181197 (+ strand) : 361 bp

3'UTR

chr07:4181198..4181396 (+ strand) : 199 bp

FASTA

>Os07t0179200-01 class=Sequence position=chr07:4179287..4181396 (+ strand)
TGGAAGATGC AGATAAAGGC AAACAAACAG CTACCCTTGA CAACATATCA AATGAAGGAA GCAAACCCTC AAACACAGAT
GGAAATGGGG CTGGTATCAG GTACGAAAAT CAGAACTCAG AAGATAAAGC TAGTAAATTA AGGTTTGATT ACTTAAAACA
AATTACTTAC TGTCAGGTTC CTTTCAGTAC tactccctcc agtcacaaat atgtgacttt tggaatgcgt gcaccgtgca
gtcaacatgt ttaaactttg accatcaata ttgctttgaa tattttgaat tcaactttta aaaatgttat gattatattt
gtcttaaaaa tagtatcaaa atattatacc agtaattcct aataaaataa ttgtcttgat gactgtgtca ttgtgcaaaa
cgtcaCTTTT TTGTGACTGG AGGGTATTTA GCAGGGATAA AAATGTCCTG TTCAACATTG AGATAACCTT ATCCTTTGAG
TACCCAATTG AGATGTTTGT TTGTATTTGC AGGGATGATC CTGGTGCGAG AGCTAGGAGC AGTCCTATTA GGGCTGATGC
AAGTTTAACA AAAGTGGATG GCAACAATGG TGCTGATACT GCAGAGGCTG GTATATCTAG AGCTGAACCT GTGCCAACCA
ATGGTAAAGA TTTAGCAATG GGCTCTACAG ACAACGGACA GCCTCAACGT GTCAGGAAGG GGCGTGGTTT TACTCAACAA
TATGCATTTG CACGTCGATA CAGGACACCA TCTCCAGAGC GTTCCCCTGT TCGGTCTCGC TACAATGATG GAAGAAATGA
TAGGTGGAAT CATTTTAATA GGTACTGCAG TTAGATTATT TACCACATTT TTTTAAAAAA AAATGATGAT TAATTTAATG
TTTGGATGCC ATCATGTGCA GGTATGGAAG AAATGGTCCC TACGGTGCAC GCTCACCAGT AAGAAGATAT CGTGGTTCCC
CAAGAGCCAG TAGTCCGTCC AGGTTGGTAT TCTTCTGATT ATCCTTGGAA TCTCCTAGTG GTCAGTACCA ATTGATTGGG
TAGAGTGGAT GAACTATTTT GAATATAGTT GTGTACTCTT CATGAGTTCA TGCCTTCTTT GGGgttaaca gtgtagtttg
ttattattta gtaccataat acccggggtt atgtgcaacg tgccgaaaca tctgattttg ttcaacttgg accataatag
tggggtttta taaaaacttt ataaaattta CTCATAACTA TATTATGATG CCTTCAAGAG TTTAGTTAAT CTGAATATTA
CCCAAGTTCA TAACTTGCTT TCATTGCCTT ATATTTCATG CCAATTCTTC TCTTAGGTAG ATAGCAGAGG CTATGCATGG
ACAAACCTCA AACTGGGTTA CATGTTAACA TAGATACAGT ATATTTTGCT TAGATCAATC AGCTTTCTTG CGTGATTCAA
ATTCACCAAA CATTTCCTTT TTATCCGCTT CCCTTTTTTA CCATTGCAAG GCCATGTTAC TTTAGCAATG AGCTATACAT
TTTTTTAAGA AACTCTGAAC CATTGCCCAG ATACCCAAGG AGAGACCGTA GCAGGAGCAG GTCACGCAGT CCATTGAGGT
ACCGTGAGCG TGGAGGATAT CGCCGCCCCA GTCCAAGGCA CAGCCGCAGC CGCAGCCCAG CGGAGCACCA GAGGCGAGAT
GTAAGAAACA GGCTTCGATC AGGTCGGGAT GGTGGTGGCC CTGATCACCG TAATAGCAGC CCTCCTGTCA ATAGAGGAAG
GTCAAGATCC AGGTCGAAGA GCCGTGATCC CTCGAAGTCC AGATCACCAG ATGCTCCTGC CAAAAAGGGG AGCTCAAAAT
ATAACCGCAG GCGCAGCAGC AGTTCAAGAT CCAGTAGCCC TGCTGGAAGT AAAGGCTTGG TTTCATACTG AGATGTGATA
TCAGAAGTTG AGGTGATATC AGGAGTTGAA AACCCTATGT TCCATGGTAG CTTGGTATTG AGTACTACCC TTTAAGAATG
ATGATGTAGT TAATGGCTTA ATGTACTCTT CTTTTGTAAC GTTTCTCATT CAGAGATTGT TGTTTTTATG CATCTTCTAT
TTGGATATGA TATTTAGACT TCTAAGTTCT 

Locus: Os07g0179200

Loading...

Locus: Os07g0179200

Loading...