Os07t0182400-01

Locus

Os07g0182400

Description

AUX/IAA protein family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA24

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA24

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 24, auxin response element-binding transcriptional factor 24

Transcript Evidence

AK103483 (DDBJ, Best hit)

Protein Evidence

Q6ZL57 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

J033130J12 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0182400-01)

RiceXPro (AK103483)

Others

Oryzabase (10911)

KEGG (Os07t0182400-01)

Transcript

1163 bp

>Os07t0182400-01 AUX/IAA protein family protein.
GTCCTCATCTCATCTTCTCCTCCAAATTCCTCTTCCACATTTCCTCCTCCTCCTCTTCTT
TCTCTCAAGAAAATCAGTAGCTAGCCATGGCGTCTTCTTCTTCTCTCAGGAGCACCAGCT
GCCTCGCCTCCGCCGCGGAGACCGACGCCGACAACCTCTGCCTCCGCCTCGGCCCGCCGG
GAAGCAGCATCACCACCACCACCACCACCGGCGGCGCCGACCCGGCGGCGAAGAGGTCCC
TCGGGGCGAAGCGGTCGCTGGAGAGCACGGACAGCATGGCCTCCGGCACCGGAACTTCCG
CCGCCGGCGACGAGCACGACGACGACACCGCCGCACCGGCCAAGGCACAGGTGGTAGGAT
GGCCACCAGTGAGGGCATACCGGAGGAACACCTTCCATCAGGCCGCCGCCGCCGCCGCCG
CAACCAAGAAGGGTGGTGATGAGAAACAGAAGCAGCAGCAGCAGGGAGGAGGGCTGTATG
TGAAGGTGAGCATGGATGGGGCACCATACCTGAGGAAGGTTGATCTCAAGATGTGCAAGG
GCTACAGGGAGCTGAGGGAGGCACTGGATCTCCTCTTCACCAAGTGCTTCTCTGCAACCG
CCTCTGACGGATGCAGCGATGGCCAGTTCGCCATTGCCTACGAGGACAAGGACGGTGACC
TCATGCTTGTTGGAGATGTGCCCTGGGAAATGTTCATCTCTTCCTGCAAGAAGTTGAGGA
TCATGAAGGGCTCTGAAGCCAGGTGATGGTCTGATGGATGATCAAAGGAGACAAATCACA
GGCTAGGACACACCACATGAGAAGATGGATGATGAATCAGAGATCATGAATCACATGGCA
TGAGATGAATGGGATCAAGAAGGGAGCAGAGGACTAGAAGAGCCCTGATGGCTTGTGCTC
TTCGTTGCTGTACAGAGAGAGTTTAGGCACTGCCTTGTTTCAGTGTTTCTGAATCCAAGA
GGGACAAGATGTATGAACTGTGTATATAGTCTTTTAATTAGGCTCATTTCTTTTTTCAGT
TTGAGTTTTGTACTGTATGAGCGAAGGCTGGAAAATATGAAAAAAGGGAGAAATTTGACT
TAAGCTTGGTCATTTCTCCACACCAAAGATTCCTTGTTTCTCTGTGTTCATATCATAAAT
ACAGTACCAAGCCAGTATTTGTC

CDS

660 bp

>Os07t0182400-01 AUX/IAA protein family protein.
ATGGCGTCTTCTTCTTCTCTCAGGAGCACCAGCTGCCTCGCCTCCGCCGCGGAGACCGAC
GCCGACAACCTCTGCCTCCGCCTCGGCCCGCCGGGAAGCAGCATCACCACCACCACCACC
ACCGGCGGCGCCGACCCGGCGGCGAAGAGGTCCCTCGGGGCGAAGCGGTCGCTGGAGAGC
ACGGACAGCATGGCCTCCGGCACCGGAACTTCCGCCGCCGGCGACGAGCACGACGACGAC
ACCGCCGCACCGGCCAAGGCACAGGTGGTAGGATGGCCACCAGTGAGGGCATACCGGAGG
AACACCTTCCATCAGGCCGCCGCCGCCGCCGCCGCAACCAAGAAGGGTGGTGATGAGAAA
CAGAAGCAGCAGCAGCAGGGAGGAGGGCTGTATGTGAAGGTGAGCATGGATGGGGCACCA
TACCTGAGGAAGGTTGATCTCAAGATGTGCAAGGGCTACAGGGAGCTGAGGGAGGCACTG
GATCTCCTCTTCACCAAGTGCTTCTCTGCAACCGCCTCTGACGGATGCAGCGATGGCCAG
TTCGCCATTGCCTACGAGGACAAGGACGGTGACCTCATGCTTGTTGGAGATGTGCCCTGG
GAAATGTTCATCTCTTCCTGCAAGAAGTTGAGGATCATGAAGGGCTCTGAAGCCAGGTGA

Protein

220 aa

>Os07t0182400-01 AUX/IAA protein family protein.
MASSSSLRSTSCLASAAETDADNLCLRLGPPGSSITTTTTTGGADPAAKRSLGAKRSLES
TDSMASGTGTSAAGDEHDDDTAAPAKAQVVGWPPVRAYRRNTFHQAAAAAAATKKGGDEK
QKQQQQGGGLYVKVSMDGAPYLRKVDLKMCKGYRELREALDLLFTKCFSATASDGCSDGQ
FAIAYEDKDGDLMLVGDVPWEMFISSCKKLRIMKGSEAR*

5'UTR

chr07:4356487..4356572 (- strand) : 86 bp

CDS

chr07:4356230..4356486 (- strand) : 257 bp

chr07:4355798..4356142 (- strand) : 345 bp

chr07:4355628..4355685 (- strand) : 58 bp

3'UTR

chr07:4355211..4355627 (- strand) : 417 bp

FASTA

>Os07t0182400-01 class=Sequence position=chr07:4355211..4356572 (- strand)
GTCCTCATCT CATCTTCTCC TCCAAATTCC TCTTCCACAT TTCCTCCTCC TCCTCTTCTT TCTCTCAAGA AAATCAGTAG
CTAGCCATGG CGTCTTCTTC TTCTCTCAGG AGCACCAGCT GCCTCGCCTC CGCCGCGGAG ACCGACGCCG ACAACCTCTG
CCTCCGCCTC GGCCCGCCGG GAAGCAGCAT CACCACCACC ACCACCACCG GCGGCGCCGA CCCGGCGGCG AAGAGGTCCC
TCGGGGCGAA GCGGTCGCTG GAGAGCACGG ACAGCATGGC CTCCGGCACC GGAACTTCCG CCGCCGGCGA CGAGCACGAC
GACGACACCG CCGCACCGGC CAAGTAAGCT CACAACCCCC TGACCCTGCA CAAACACCTG TAACAACAAC AACACAAAAC
TAACCATGGC TAAAATTCTC CTTGGTTCAG GGCACAGGTG GTAGGATGGC CACCAGTGAG GGCATACCGG AGGAACACCT
TCCATCAGGC CGCCGCCGCC GCCGCCGCAA CCAAGAAGGG TGGTGATGAG AAACAGAAGC AGCAGCAGCA GGGAGGAGGG
CTGTATGTGA AGGTGAGCAT GGATGGGGCA CCATACCTGA GGAAGGTTGA TCTCAAGATG TGCAAGGGCT ACAGGGAGCT
GAGGGAGGCA CTGGATCTCC TCTTCACCAA GTGCTTCTCT GCAACCGCCT CTGACGGATG CAGCGATGGC CAGTTCGCCA
TTGCCTACGA GGACAAGGAC GGTGACCTCA TGCTTGTTGG AGATGTGCCC TGGGAGTAAG TGCCATCATC ATCATCATCA
TCATCAGATA TTCAGAATAT TCAGATGACA TGTTATCAGT TTCTTCAGAT CTGTATCTAA CTCTAGGTTG CTCTGTTTCT
TTTGCAGAAT GTTCATCTCT TCCTGCAAGA AGTTGAGGAT CATGAAGGGC TCTGAAGCCA GGTGATGGTC TGATGGATGA
TCAAAGGAGA CAAATCACAG GCTAGGACAC ACCACATGAG AAGATGGATG ATGAATCAGA GATCATGAAT CACATGGCAT
GAGATGAATG GGATCAAGAA GGGAGCAGAG GACTAGAAGA GCCCTGATGG CTTGTGCTCT TCGTTGCTGT ACAGAGAGAG
TTTAGGCACT GCCTTGTTTC AGTGTTTCTG AATCCAAGAG GGACAAGATG TATGAACTGT GTATATAGTC TTTTAATTAG
GCTCATTTCT TTTTTCAGTT TGAGTTTTGT ACTGTATGAG CGAAGGCTGG AAAATATGAA AAAAGGGAGA AATTTGACTT
AAGCTTGGTC ATTTCTCCAC ACCAAAGATT CCTTGTTTCT CTGTGTTCAT ATCATAAATA CAGTACCAAG CCAGTATTTG
TC

Locus: Os07g0182400

Loading...

Locus: Os07g0182400

Loading...