Os07t0187700-01

Locus

Os07g0187700

Description

WD40 protein, Regulation of the plasma membrane localization of phosphate transporters, Phosphate uptake and translocation

RAP-DB Gene Symbol Synonym(s)

PHF1, OsPHF1, OsWD40-137, OsSEC12

RAP-DB Gene Name Synonym(s)

PHOSPHATE TRANSPORTER TRAFFIC FACILITATOR 1, PHOSPHATE TRANSPORTER TRAFFIC FACILITATOR1, SEC12 ortholog

CGSNL Gene Symbol

PHF1

CGSNL Gene Name

PHOSPHATE TRANSPORTER TRAFFIC FACILITATOR 1

Oryzabase Gene Symbol Synonym(s)

OsPHF1, OsWD40-137, OsSEC12

Oryzabase Gene Name Synonym(s)

PHOSPHATE TRANSPORTER TRAFFIC FACILITATOR1, SEC12 ortholog, Phosphate transporter facilitator 1

Transcript Evidence

AK111777

Protein Evidence

Q6Z4F3

Literature

PMID: 21753117

PMID: 22429805

PMID: 25724641

Note

Manual Curation

July 15, 2015

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

WD40/YVTN repeat-like-containing domain (IPR015943)

WD40-repeat-containing domain (IPR017986)

WD40 repeat (IPR001680)

Full-length cDNA

J023077D02 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0187700-01)

RiceXPro (AK111777)

Others

Oryzabase (9624)

KEGG (Os07t0187700-01)

Transcript

1778 bp

>Os07t0187700-01 WD40 protein, Regulation of the plasma membrane localization of phosphate transporters, Phosphate uptake and translocation
ACAGTCAAAGGATAACCCAGCGAATATCCCATCCATCCAACCCGTCCATCCGGGCCCACC
ACAACGCGTCATCAATCAACCCATCCATCCCCCGCAATAATTTCTCTCGCTTCCGCCGGT
CGCCGCCTCCCTCCGCCGCTTTCTTCCCCTTTAAAACCCTCCCAAAATTCAAACGCGACC
AAGCCGCCGGCGAGGTGAACGAAACCCAACCATGGCAGGCGGCGGAGGTGGCGAGGGGAA
GGTGGCGTGCGCGGCGTGGATCCGGCGCCGGGAGGAGAAGGAGAAGGCGACGCGCGTCTT
CGCGGCGTACGGGCGGGCGGGGTCGCCGCCGGCCGTGGAGGTGCTCGGGTTCGACTCCAA
GGAGTGCTCCCTCTCCGAACCCCTGGCGAGGGCGGAGCTCGGGGAGGAGCCGGGCGACGC
GCCGCGTGGCATCACGGTGCACCCCAGCGGCGACGAGCTCGTCTGCGCCACGGCCAAGGG
GTGCAGGCTATTCAAGCTGATTTTTGAAGAGTTCACTGTTCGACTTATTTCAAGAGACGC
TCCACCACTTGAATCCGTTGGACCGCAGAAGTGTCTTGCTTTTAGCACTGATGGATCTAA
ATTTGCCATTGGTGGTGAGGATGGGCATCTCAGAATATTTCATTGGCCGAGCATGAATGT
GCTCTTAGATGAACCCAAGGCTCATAAGTCCTTCCGGGACATGGATATCAGCTTAGATTC
AGAATTTTTAGTTTCCACATCCACTGATGGTTCTGCAAGAATATGGAAGATAGATGAGGG
GGTACCATTGGTCAATTTGACTCGATCTGCGGATGAGAAGATTGAATGTTGCCGCTTTTC
TAGGGATGGCATGAAACCATTCCTGTTTTGCACCGTTGCAAAAGGTAACAAAGTTGTAAC
TGTTGTCTGGAACATAAGTGACTGGAGTCGAATTGGATACAAGAGACTTCTGGGAAAACC
TATCTCCACACTTTCAGTTAGCATGGATGGGAAGTATCTGGCTTTGGGGAGCCATGATGG
TGATTTCTGTGCTGTGGATGTAAAGAAGATGGATGTTTCTCACTGGAGCAAGAAGGTCCA
TCTTGGTTCTCCGGTTTCCTCAATTGAATTTTGTCCTACTGAAAGGGCCGTAATCTCCAC
ATCGCATCAATGGGGAGCAGAGCTGACAAAGCTGAATGTCCCTGCTGACTGGAAAGAATG
GCAAGTCTGGCTCATACTCTTATCTCTTTTCCTAGTGTCAGCCATCCTGTTCTATATGTT
CTACGAGCGCTCCGATTCCTTCTGGAACTTTCCAATGGGGCAGCATCAGCCAGCCAAGCC
ATGGAGTGTCATGAAGGAGTCTCCTCCAGTTCCTGAGGACCAGAACCCCTGGTGAATTAT
CTTTCAAGCAATCAAGCATTTGGGTGTTGTTTTATTTCATAATGAAAGGGTTTTTTCCAA
GCCTAATTCATGTTGTACCATTTTACTTGTTCGCCGATCTGACCACGTCAGTATTTATCT
AGGTAAATCAGTAAAATGCCACTGTAATTGGTGGTCTGATGGTAGTTATGAAAATGCCAT
CGACTTCCAATGAGACTTTCAGTGGCATTTTTAAGTCTATTGTACCTTGCAGTGGGATTT
ATCCACGTGCTTATTTACCCCCTTCTCTTTGGTAGTCAATAACTGAATTTATCAGTGTGT
TCTACTTCTGTATATGTGGGTTGGGATGTGAGTACAAGTACATGTGAACTCAGCTTTAAT
TAAGCCGCTGGCAGTTGTTAATTGCAGGATGTTTTTTT

CDS

1164 bp

>Os07t0187700-01 WD40 protein, Regulation of the plasma membrane localization of phosphate transporters, Phosphate uptake and translocation
ATGGCAGGCGGCGGAGGTGGCGAGGGGAAGGTGGCGTGCGCGGCGTGGATCCGGCGCCGG
GAGGAGAAGGAGAAGGCGACGCGCGTCTTCGCGGCGTACGGGCGGGCGGGGTCGCCGCCG
GCCGTGGAGGTGCTCGGGTTCGACTCCAAGGAGTGCTCCCTCTCCGAACCCCTGGCGAGG
GCGGAGCTCGGGGAGGAGCCGGGCGACGCGCCGCGTGGCATCACGGTGCACCCCAGCGGC
GACGAGCTCGTCTGCGCCACGGCCAAGGGGTGCAGGCTATTCAAGCTGATTTTTGAAGAG
TTCACTGTTCGACTTATTTCAAGAGACGCTCCACCACTTGAATCCGTTGGACCGCAGAAG
TGTCTTGCTTTTAGCACTGATGGATCTAAATTTGCCATTGGTGGTGAGGATGGGCATCTC
AGAATATTTCATTGGCCGAGCATGAATGTGCTCTTAGATGAACCCAAGGCTCATAAGTCC
TTCCGGGACATGGATATCAGCTTAGATTCAGAATTTTTAGTTTCCACATCCACTGATGGT
TCTGCAAGAATATGGAAGATAGATGAGGGGGTACCATTGGTCAATTTGACTCGATCTGCG
GATGAGAAGATTGAATGTTGCCGCTTTTCTAGGGATGGCATGAAACCATTCCTGTTTTGC
ACCGTTGCAAAAGGTAACAAAGTTGTAACTGTTGTCTGGAACATAAGTGACTGGAGTCGA
ATTGGATACAAGAGACTTCTGGGAAAACCTATCTCCACACTTTCAGTTAGCATGGATGGG
AAGTATCTGGCTTTGGGGAGCCATGATGGTGATTTCTGTGCTGTGGATGTAAAGAAGATG
GATGTTTCTCACTGGAGCAAGAAGGTCCATCTTGGTTCTCCGGTTTCCTCAATTGAATTT
TGTCCTACTGAAAGGGCCGTAATCTCCACATCGCATCAATGGGGAGCAGAGCTGACAAAG
CTGAATGTCCCTGCTGACTGGAAAGAATGGCAAGTCTGGCTCATACTCTTATCTCTTTTC
CTAGTGTCAGCCATCCTGTTCTATATGTTCTACGAGCGCTCCGATTCCTTCTGGAACTTT
CCAATGGGGCAGCATCAGCCAGCCAAGCCATGGAGTGTCATGAAGGAGTCTCCTCCAGTT
CCTGAGGACCAGAACCCCTGGTGA

Protein

388 aa

>Os07t0187700-01 WD40 protein, Regulation of the plasma membrane localization of phosphate transporters, Phosphate uptake and translocation
MAGGGGGEGKVACAAWIRRREEKEKATRVFAAYGRAGSPPAVEVLGFDSKECSLSEPLAR
AELGEEPGDAPRGITVHPSGDELVCATAKGCRLFKLIFEEFTVRLISRDAPPLESVGPQK
CLAFSTDGSKFAIGGEDGHLRIFHWPSMNVLLDEPKAHKSFRDMDISLDSEFLVSTSTDG
SARIWKIDEGVPLVNLTRSADEKIECCRFSRDGMKPFLFCTVAKGNKVVTVVWNISDWSR
IGYKRLLGKPISTLSVSMDGKYLALGSHDGDFCAVDVKKMDVSHWSKKVHLGSPVSSIEF
CPTERAVISTSHQWGAELTKLNVPADWKEWQVWLILLSLFLVSAILFYMFYERSDSFWNF
PMGQHQPAKPWSVMKESPPVPEDQNPW*

5'UTR

chr07:4682480..4682690 (+ strand) : 211 bp

CDS

chr07:4682691..4682864 (+ strand) : 174 bp

chr07:4682997..4683097 (+ strand) : 101 bp

chr07:4683820..4683952 (+ strand) : 133 bp

chr07:4684319..4684410 (+ strand) : 92 bp

chr07:4684705..4684804 (+ strand) : 100 bp

chr07:4684892..4684964 (+ strand) : 73 bp

chr07:4685046..4685166 (+ strand) : 121 bp

chr07:4685626..4685745 (+ strand) : 120 bp

chr07:4686909..4686979 (+ strand) : 71 bp

chr07:4687065..4687243 (+ strand) : 179 bp

3'UTR

chr07:4687244..4687646 (+ strand) : 403 bp

FASTA

>Os07t0187700-01 class=Sequence position=chr07:4682480..4687646 (+ strand)
ACAGTCAAAG GATAACCCAG CGAATATCCC ATCCATCCAA CCCGTCCATC CGGGCCCACC ACAACGCGTC ATCAATCAAC
CCATCCATCC CCCGCAATAA TTTCTCTCGC TTCCGCCGGT CGCCGCCTCC CTCCGCCGCT TTCTTCCCCT TTAAAACCCT
CCCAAAATTC AAACGCGACC AAGCCGCCGG CGAGGTGAAC GAAACCCAAC CATGGCAGGC GGCGGAGGTG GCGAGGGGAA
GGTGGCGTGC GCGGCGTGGA TCCGGCGCCG GGAGGAGAAG GAGAAGGCGA CGCGCGTCTT CGCGGCGTAC GGGCGGGCGG
GGTCGCCGCC GGCCGTGGAG GTGCTCGGGT TCGACTCCAA GGAGTGCTCC CTCTCCGAAC CCCTGGTACG TACGGGAGCT
CCCCCCTCTC CTCCTCCTCC TCCTCCTCCT CCTCCGAGCT CCCAAGGAAT TCGAGGTTTG GTTCGCCGGC TTGACTTCCG
GGGTCGTGGT TGTGTGGTTT GTTTGTTTGT GCTGCAGGCG AGGGCGGAGC TCGGGGAGGA GCCGGGCGAC GCGCCGCGTG
GCATCACGGT GCACCCCAGC GGCGACGAGC TCGTCTGCGC CACGGCCAAG GGGTGCAGGT GCGTGCCTCC ACTGCTTCTC
TTCTCGTTGA CTGTTCTATC ATTTGCGGGA ATTTCTCAGG CGGGGAGGGG AGGGGTGATA TGATTAGTTA GGAGTTCGGT
GTTCTACCGG TAGATTATTG AGCTAATGCC TGTGTAGTGT CGGAGATTTC GGATTATTAG TTCGATTCAG CTGATTTGAG
GGTGGTAATT TGGTTAATTG TGATGCGGGA GCTGGTTTGG TTGCTGCTGG CTGCCTGGCT GGATTAGGTG ATTTAGAAAG
CAGTGTGAAT CCGTCTGTTT AGACTTCAGA TTGTAGAGGT CTGTGTTATC AATGTGGCTA ATTATGTTTA GATTGTAGTG
CGGAATTGAC TTTCTGTGTT CATTTGATCA TTTGCTGTTC CAGTAACGTT CAATTAGGCT TTACACTTCA GGTTTTCTAT
AGAAGGGTTG GCTTGGATGT TGCAACCTAA AATAAAAAGG GCCACCGAAG TTGATCTTTA GTAGGGTTAA CTACCTCAAT
GAAATGATCA TTAGAATAGC ACACATGTTG ACTTGTTAAT CAAATTATAA ATGCACAGTA TATATATATA ATTCCATGCC
ATTTTGTACT TTTTAGTTCT GATTGTGTTA TCATTTTATC AAAGCCTTCT GTTTGCACTG TTACAACCTG CTTTCTCTTT
TTTCTGTTCT CTTTCACTAA GACTAGAACT TTATAATTAA ACCACATGTT TGAACTGAAG GCTATTCAAG CTGATTTTTG
AAGAGTTCAC TGTTCGACTT ATTTCAAGAG ACGCTCCACC ACTTGAATCC GTTGGACCGC AGAAGTGTCT TGCTTTTAGC
ACTGATGGAT CTAAATTTGC CATTGGTGGT GAGGTATCGG ATTGCTATAT GTTGATATTG GAGTTTTACT GATCAGTTCT
CTCTCTCTCT CTCTCTCTCT CTCTCTATTT TCTAGTTTGC TTCTATTTGG TGATTATGTG TTTCCATATG CTGCATTTAT
ACATCGTTAA GAAGTACTAT ATGTGTATTA TAGAAGCCAT GTGATTTTAG GCACAATATC CACTGTTGTA CCATTCTGTC
AGATTATTCC ATCCAGAATT CCAGATGGTT CAGTTTTTTA TGGTCTGGTG TTATTGCCCA GTGTATTTAG TTTGATAATA
ATGCTGCTCT CTAGCTGAAC TTGTACAAAG TATCTTTCTA TGGTTCTTAC AATGCTTTAT TTTATTTTTA CCACTATAGG
ATGGGCATCT CAGAATATTT CATTGGCCGA GCATGAATGT GCTCTTAGAT GAACCCAAGG CTCATAAGTC CTTCCGGGAC
ATGGATATCA GGTTAGGGCA AGTGCAAGCA TAATTATTTT CCTTTATTAT TTGCAAAAGA ATCCCAGGAT ATTCTCATCT
GTTGAACAAG TGTTGTTGTA AATGGCGCAA TCATGTAGCC GTTATCTTGA GAGAGTAACC AAGAACTTTG ATAACGTAGC
AGTAGTGTTG GTCCAAACCT TAATGAAGCA TTTTGGTCTT GGAAGACTCT TTTTTAGACC GAAGCGATTC TTTGAACCTT
TGGTTTTCGT CCCTGTGCTT TATTGTGAAT TGACTTTTGC AATACTGCTG CTTTTCCTCT TGTAGCTTAG ATTCAGAATT
TTTAGTTTCC ACATCCACTG ATGGTTCTGC AAGAATATGG AAGATAGATG AGGGGGTACC ATTGGTCAAT TTGACTCGAT
CTGCGGTATG ATGCGATAAA TTTGTGCAAG TCATGTTCTC TTGTTGAGAT ACTGAAAGCC TTAACCATTT GGTGTTCTGG
TTTTCTATGC AGGATGAGAA GATTGAATGT TGCCGCTTTT CTAGGGATGG CATGAAACCA TTCCTGTTTT GCACCGTTGC
AAAAGGTATA CTTTCTATTG TGGTCCAGAA ATAGATTTAT GCATATCAGA TGATTTTTCT ATATATGTGC TTTGTCATTG
GAACAGGTAA CAAAGTTGTA ACTGTTGTCT GGAACATAAG TGACTGGAGT CGAATTGGAT ACAAGAGACT TCTGGGAAAA
CCTATCTCCA CACTTTCAGT TAGCATGGAT GGGAAGTATC TGGCTTTGTA AGTACATATA AATACTGTTG ATCTTATCAT
ACTGAACAAG TATATAACTC CATTGCATTT CTAGGAACAT TTACAATGCC AAATTTCAAG ACTAACATAA GCTACTTTCT
CCTAGTAACT TCACTATTTT GTCCTTTTTG AAGAGCTCAA AAACTTGCTT GCATTTTTTT GTTACATTCT CACATTGACA
TGTAATATAT CAACAACTTG AAACAACTGT CACATAAATA ATAACAAAGA ATTACTCTAG TTGACAAGGA TGTTGCGTAG
CTCTGAAAAA AATGGACGAA AAACATTAAC ATTATAAATT GTAATAGTGA CAGTATCAGC TGGAGTAATG TTTTTTTCCT
AATAAATATG CAGTGCCCCA ATACTAGCTA ACATATTCTA AACTGAATTG CTTTTGATGT ATTTAGTGCA CCGACATGTG
AATGAATTCT GTATTTCTTC TTTCAGGGGG AGCCATGATG GTGATTTCTG TGCTGTGGAT GTAAAGAAGA TGGATGTTTC
TCACTGGAGC AAGAAGGTCC ATCTTGGTTC TCCGGTTTCC TCAATTGAAT TTTGTCCTAC TGAAAGGTAC TGGAACTCTG
TAAAGATGGC ATGTTTATCA CATCTTGAAT CTTATGGATT TCTAGTTTGT TGTACACTGC TGTTGTACTG ATTTCTAGTA
AGGTAGTAGC TTAGTGTTCA CTGGCATGTA GGCGCCATAA TGTCAGACTC ATGGTTGTTA AGGCGTCGCT ATGGCGTCGC
TATAGCACTA GGGCGTGCCG AGGGGTTAAG GCGTCCCTCC GCCTTAAGGG CTTAACGCCA TAACCCAGAG AGAGAGAAAG
AGAGAGGTGA AGGCAGCAGC AACTACCCCT TTTCACTGTT CTCTGCTCCA TGTCATTGCC ATCTTACTCC TCAGCTCTGG
TTTCCACTCT CTTCCTCTCT CTCCTGTGCC AGATTCATTT TGACTAAGGG AGCAGCGCCA GATCTATCCA AGGGAAGAGA
AGCATAGCTG GATTCGTTCT GAATGAGGGG AGAAAGGAGC ACATATAGAG GAGCAGAGCT AGCACGAGGA AAAAGATCAG
GGGAGAAAGG AGCACATATA GAAGAGCAGA GCTAGCACGA GGAAGAAGAA CTGGCGCGAG GAAGAAGCGA TGCACAGGCG
TGAGGAAGAA GCGACATCGG AGGCGGCGCT GTGAGAGGAG AGACGCACCT GGTGTGGGTA TTAGGGTTGT TTCCTTGACC
ATGGGCTGGT ATGAAGGTTA TTGGGCTTTT GTGGGCTGGC CTGCTAGGCT AATTTTCTCT CTCCCTCTTC TGATCGCTGC
TAATCACGTA GATTAAGGCG TCGCCACGCC TTAGCGCATT ACCGCTATAG CGTAAGGCGT GGGTGGGTCG CCTCAGGTCG
CCTTACCGCC TTAACAACCA TGGTCAGACT ATCAAATGCC ATGCTTATAA GTTATAAATC AATGCTTCAT AGATTGTAAT
TGTCTGTGTA TGCCTGCAGG CTGCACTGCA TAATGTCTTA AGTGGGATGT GAGTCTGAAT GTTCATCTTT TACTAAATTT
GCTTTAGTTT AGCCTGGAAA AGATTGCAAG ATAACATCTT CCTCCTGCTG GGTTTGGTAG GGATGGCCCT TATGCATTTC
ATTTATTCAT GCAAGAAATG TTTCTCTTAA AACTAAATGA CCTGTCCTTC TCCAATTTCC GGAGCATCTC TTTGTTTATG
TTATAACATG ATGCCTGCTG ATACCGCAGG GCCGTAATCT CCACATCGCA TCAATGGGGA GCAGAGCTGA CAAAGCTGAA
TGTCCCTGCT GACTGGAAAG GTACATGTCT CATAAAATGC TTCTTGGCTC TCCTGTGGTA TAATTTACCA TACTAACGAA
ATCTTTTTGT GTTATTCTTC TGCAGAATGG CAAGTCTGGC TCATACTCTT ATCTCTTTTC CTAGTGTCAG CCATCCTGTT
CTATATGTTC TACGAGCGCT CCGATTCCTT CTGGAACTTT CCAATGGGGC AGCATCAGCC AGCCAAGCCA TGGAGTGTCA
TGAAGGAGTC TCCTCCAGTT CCTGAGGACC AGAACCCCTG GTGAATTATC TTTCAAGCAA TCAAGCATTT GGGTGTTGTT
TTATTTCATA ATGAAAGGGT TTTTTCCAAG CCTAATTCAT GTTGTACCAT TTTACTTGTT CGCCGATCTG ACCACGTCAG
TATTTATCTA GGTAAATCAG TAAAATGCCA CTGTAATTGG TGGTCTGATG GTAGTTATGA AAATGCCATC GACTTCCAAT
GAGACTTTCA GTGGCATTTT TAAGTCTATT GTACCTTGCA GTGGGATTTA TCCACGTGCT TATTTACCCC CTTCTCTTTG
GTAGTCAATA ACTGAATTTA TCAGTGTGTT CTACTTCTGT ATATGTGGGT TGGGATGTGA GTACAAGTAC ATGTGAACTC
AGCTTTAATT AAGCCGCTGG CAGTTGTTAA TTGCAGGATG TTTTTTT