Os07t0203700-01

Locus

Os07g0203700

Description

Cleavage and polyadenylation specificity factor, A subunit, C-terminal domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SPL5

CGSNL Gene Name

SPOTTED LEAF 5

Oryzabase Gene Symbol Synonym(s)

spl5(bl6,spl5-1), bl6, spl5, SF3b3

Oryzabase Gene Name Synonym(s)

spotted leaf5, spotted leaf 5, spotted leaf-5, splicing factor 3b subunit 3

Transcript Evidence

AK064566 (DDBJ, Best hit)

Protein Evidence

NP_187802.2 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: nucleus (GO:0005634)

Molecular Function: nucleic acid binding (GO:0003676)

Functional domain (InterPro)

Cleavage/polyadenylation specificity factor, A subunit, C-terminal (IPR004871)

Full-length cDNA

002-112-D04 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0203700-01)

RiceXPro (AK064566)

Others

Oryzabase (812)

KEGG (Os07t0203700-01)

Transcript

2338 bp

>Os07t0203700-01 Cleavage and polyadenylation specificity factor, A subunit, C-terminal domain containing protein.
GGAGACTTGATAATTCATCTTCTAGTTGTGCAACGAGTGGTGATTTTCGGAAAGATTTTG
CAGCTAATATTCGCAAGTTTGCTGTAATTGGAACTCACGAACCTTCTGTGCATATCATTT
CGTTGGAACCTGGAGAAGCATTTCAGCAACTTGCTGTTGGGCATATATCAGTAAACAACG
CGCTCGGCACTCCTATCAGTGGTTGTATACCTGAAAATGTTAGGTTTGTAGCAGCTGCAA
GGTTCTACATTCTTGCAGGACTAAGGAATGGAATGCTACTGAGGTTTGAGTCACAAACAA
GCAAAGGGCATTGTTTCCCTGGTTCCTTTTACAAGGAGTCCTCTACCCCTTGTGATGATA
CATCCCTTATGTTGATTGCTGTACGGCGTATTGGAATCACTCCTGTAGTTTTGGTACCGT
TGCATGACAGAGCCAATGCTGACATTATTGTTCTCGGTGATAGGCCTTGGCTATTGCAAT
CTGCTAGACACAGCTTGGCATATTCATCCATCTCATTTCTGCCTGCTTCCCATGTGACAC
CAGTGTCTTCTACTGATTGCCCCAGTGGTCTGCTGTTTGTTTCGGAGAACTGTTTGCATT
TGGTTGAAATGGTTCATGGCAAAAGACTAAATGCACAGAAGTTTTCGATTGGAGGGACTC
CAAGGAAAGTGTTATACCACAGTGATAGTAGAACACTGTTGGTGCTGAGAACTGGGTTAA
CCAGTGTATCCTGTTCTTCAGATATTGTTCAAATAGATCCAAGTAATGGGGCATTGCTTT
CCAGATTCAAGTGCGAACCTGGTGAAACAGCAAAATGCATGCAAATTGCAAAGATAGGGA
ATGATCAAGTATTAATCGTTGGAACTAGTAAGTCCAATGGCCGACCAATGATGCCAAACG
GTGAAGCAGAAAGTATCAAGGGTCGTCTAATTCTTTTAAGCTTGGAGACTATTGAAAGTC
CTCGTGAGAGCGGTTCGTTTACTGCAGCTTCTAATTTGAATTCATCTCATGCTGGTTCTC
CATTCCCGGAATTTGTTGGATATGCAGCAGAGGAGCTGTCTAGTAACAGCATGTGCAGCA
GTCCTGATGAAGTTTGCTGCAATCAAATTCAACCTGAACTCATGGCAGGCCATTTGAGAT
CACTAGTCCAACATACATTCAATGGCGCTGTTCTTGCTGTACATCCATATCTAGATAGAT
ATGTGTTGGCAGCAGCTGGAAATGTGCTTTTTGTATTTGGATTTTTAAATGAAAGTCCCC
ATCGGATAAAAAAGTATACTACGAGTAGGACACGATTTACAATAACCTGTTTGAAGACGT
ATGCATCACGGATTGCAGTGGGTGATTGCCGCGATGGTGTTCTCTTCTATTCTTATCATG
AGAATCTTAGGAAGTTGGAACTGATCTATTCTGATCCTGCCCAACGGCTAGTGGGTGATG
TTGCCCTTTTGAGCTGTGAAACTGCTGTTGTATCAGATCGACGAGGGAGCATATCTGTAC
TGTCTTGCCCAAGATTAGAAGTATCCGAAAGTCCAGAGAAGAACCTAGCGGTGCATTGTT
CATTTTACATGGGTGAAACAGCTATGAGCATCCAGAAGGTTGCATTTAAGCATTGGCTTC
CAATTGATGATTTGACAGAACCAGTGTTGGAGTCGGTATACAACTGTGTCGTCGCAAGCA
CTCTGCTGGGGAGTATCTTTGTTATGATTCCACTCACAAGTGAGGAGCATCAAATGTTGC
AAGATGTCCAAGAAAGACTTTCGGTTCACCCATTGACTGCTCCACTCTTAGGAAATGATC
ATGCAGAGTTTCGTCGCCGTGGTATCCCGTCGGGAGTACCGCCCATTCTGGATGGCGACA
TGCTTGTGCAGTTCCTGGAGCTCACCAGCGAACAACAGCACGATGTTCTCAATATTGTTT
CTCCTGGAAAGAAGAGGCAACACGATATCTCGGTTTTCCAGGTCATGCGAGCATTAGAGA
GGGTGCATTACGCACTCAACTGAGGCGTTCAACAATCCATTCAACCCGGTCACTGTTCTT
ACCGACATGGCTGTCTCCAACCTGCTGATATTTGGGTGGCATCATCGCTGAATTTGGATC
CGAGCCGAGCACCGAGTTGTTGCAGCTGAAGCTGCTACTGGAGCACATACCCAGAACATA
CCAAATCTCAGCTGTAGTGAGGTGCTGTGTTTTGCTGTGGGATGATAGGCCCATCTGATG
TCGCAATAGTGTGTCATTGCTCTAGTGCAATCTTTGTAAATAACGAATAATATTTTGGCA
GAAGGATGTGGATACAAATCCTTTTGCCCAGTGAAAGGAACAACCCTCGTGAACGCAT

CDS

2001 bp

>Os07t0203700-01 Cleavage and polyadenylation specificity factor, A subunit, C-terminal domain containing protein.
AGACTTGATAATTCATCTTCTAGTTGTGCAACGAGTGGTGATTTTCGGAAAGATTTTGCA
GCTAATATTCGCAAGTTTGCTGTAATTGGAACTCACGAACCTTCTGTGCATATCATTTCG
TTGGAACCTGGAGAAGCATTTCAGCAACTTGCTGTTGGGCATATATCAGTAAACAACGCG
CTCGGCACTCCTATCAGTGGTTGTATACCTGAAAATGTTAGGTTTGTAGCAGCTGCAAGG
TTCTACATTCTTGCAGGACTAAGGAATGGAATGCTACTGAGGTTTGAGTCACAAACAAGC
AAAGGGCATTGTTTCCCTGGTTCCTTTTACAAGGAGTCCTCTACCCCTTGTGATGATACA
TCCCTTATGTTGATTGCTGTACGGCGTATTGGAATCACTCCTGTAGTTTTGGTACCGTTG
CATGACAGAGCCAATGCTGACATTATTGTTCTCGGTGATAGGCCTTGGCTATTGCAATCT
GCTAGACACAGCTTGGCATATTCATCCATCTCATTTCTGCCTGCTTCCCATGTGACACCA
GTGTCTTCTACTGATTGCCCCAGTGGTCTGCTGTTTGTTTCGGAGAACTGTTTGCATTTG
GTTGAAATGGTTCATGGCAAAAGACTAAATGCACAGAAGTTTTCGATTGGAGGGACTCCA
AGGAAAGTGTTATACCACAGTGATAGTAGAACACTGTTGGTGCTGAGAACTGGGTTAACC
AGTGTATCCTGTTCTTCAGATATTGTTCAAATAGATCCAAGTAATGGGGCATTGCTTTCC
AGATTCAAGTGCGAACCTGGTGAAACAGCAAAATGCATGCAAATTGCAAAGATAGGGAAT
GATCAAGTATTAATCGTTGGAACTAGTAAGTCCAATGGCCGACCAATGATGCCAAACGGT
GAAGCAGAAAGTATCAAGGGTCGTCTAATTCTTTTAAGCTTGGAGACTATTGAAAGTCCT
CGTGAGAGCGGTTCGTTTACTGCAGCTTCTAATTTGAATTCATCTCATGCTGGTTCTCCA
TTCCCGGAATTTGTTGGATATGCAGCAGAGGAGCTGTCTAGTAACAGCATGTGCAGCAGT
CCTGATGAAGTTTGCTGCAATCAAATTCAACCTGAACTCATGGCAGGCCATTTGAGATCA
CTAGTCCAACATACATTCAATGGCGCTGTTCTTGCTGTACATCCATATCTAGATAGATAT
GTGTTGGCAGCAGCTGGAAATGTGCTTTTTGTATTTGGATTTTTAAATGAAAGTCCCCAT
CGGATAAAAAAGTATACTACGAGTAGGACACGATTTACAATAACCTGTTTGAAGACGTAT
GCATCACGGATTGCAGTGGGTGATTGCCGCGATGGTGTTCTCTTCTATTCTTATCATGAG
AATCTTAGGAAGTTGGAACTGATCTATTCTGATCCTGCCCAACGGCTAGTGGGTGATGTT
GCCCTTTTGAGCTGTGAAACTGCTGTTGTATCAGATCGACGAGGGAGCATATCTGTACTG
TCTTGCCCAAGATTAGAAGTATCCGAAAGTCCAGAGAAGAACCTAGCGGTGCATTGTTCA
TTTTACATGGGTGAAACAGCTATGAGCATCCAGAAGGTTGCATTTAAGCATTGGCTTCCA
ATTGATGATTTGACAGAACCAGTGTTGGAGTCGGTATACAACTGTGTCGTCGCAAGCACT
CTGCTGGGGAGTATCTTTGTTATGATTCCACTCACAAGTGAGGAGCATCAAATGTTGCAA
GATGTCCAAGAAAGACTTTCGGTTCACCCATTGACTGCTCCACTCTTAGGAAATGATCAT
GCAGAGTTTCGTCGCCGTGGTATCCCGTCGGGAGTACCGCCCATTCTGGATGGCGACATG
CTTGTGCAGTTCCTGGAGCTCACCAGCGAACAACAGCACGATGTTCTCAATATTGTTTCT
CCTGGAAAGAAGAGGCAACACGATATCTCGGTTTTCCAGGTCATGCGAGCATTAGAGAGG
GTGCATTACGCACTCAACTGA

Protein

667 aa

>Os07t0203700-01 Cleavage and polyadenylation specificity factor, A subunit, C-terminal domain containing protein.
RLDNSSSSCATSGDFRKDFAANIRKFAVIGTHEPSVHIISLEPGEAFQQLAVGHISVNNA
LGTPISGCIPENVRFVAAARFYILAGLRNGMLLRFESQTSKGHCFPGSFYKESSTPCDDT
SLMLIAVRRIGITPVVLVPLHDRANADIIVLGDRPWLLQSARHSLAYSSISFLPASHVTP
VSSTDCPSGLLFVSENCLHLVEMVHGKRLNAQKFSIGGTPRKVLYHSDSRTLLVLRTGLT
SVSCSSDIVQIDPSNGALLSRFKCEPGETAKCMQIAKIGNDQVLIVGTSKSNGRPMMPNG
EAESIKGRLILLSLETIESPRESGSFTAASNLNSSHAGSPFPEFVGYAAEELSSNSMCSS
PDEVCCNQIQPELMAGHLRSLVQHTFNGAVLAVHPYLDRYVLAAAGNVLFVFGFLNESPH
RIKKYTTSRTRFTITCLKTYASRIAVGDCRDGVLFYSYHENLRKLELIYSDPAQRLVGDV
ALLSCETAVVSDRRGSISVLSCPRLEVSESPEKNLAVHCSFYMGETAMSIQKVAFKHWLP
IDDLTEPVLESVYNCVVASTLLGSIFVMIPLTSEEHQMLQDVQERLSVHPLTAPLLGNDH
AEFRRRGIPSGVPPILDGDMLVQFLELTSEQQHDVLNIVSPGKKRQHDISVFQVMRALER
VHYALN*

5'UTR

chr07:5575693..5575694 (- strand) : 2 bp

CDS

chr07:5575093..5575692 (- strand) : 600 bp

chr07:5572932..5573242 (- strand) : 311 bp

chr07:5572154..5572466 (- strand) : 313 bp

chr07:5571434..5571589 (- strand) : 156 bp

chr07:5571197..5571335 (- strand) : 139 bp

chr07:5570707..5570783 (- strand) : 77 bp

chr07:5568923..5569044 (- strand) : 122 bp

chr07:5568303..5568411 (- strand) : 109 bp

chr07:5568049..5568222 (- strand) : 174 bp

3'UTR

chr07:5567714..5568048 (- strand) : 335 bp

FASTA

>Os07t0203700-01 class=Sequence position=chr07:5567714..5575694 (- strand)
GGAGACTTGA TAATTCATCT TCTAGTTGTG CAACGAGTGG TGATTTTCGG AAAGATTTTG CAGCTAATAT TCGCAAGTTT
GCTGTAATTG GAACTCACGA ACCTTCTGTG CATATCATTT CGTTGGAACC TGGAGAAGCA TTTCAGCAAC TTGCTGTTGG
GCATATATCA GTAAACAACG CGCTCGGCAC TCCTATCAGT GGTTGTATAC CTGAAAATGT TAGGTTTGTA GCAGCTGCAA
GGTTCTACAT TCTTGCAGGA CTAAGGAATG GAATGCTACT GAGGTTTGAG TCACAAACAA GCAAAGGGCA TTGTTTCCCT
GGTTCCTTTT ACAAGGAGTC CTCTACCCCT TGTGATGATA CATCCCTTAT GTTGATTGCT GTACGGCGTA TTGGAATCAC
TCCTGTAGTT TTGGTACCGT TGCATGACAG AGCCAATGCT GACATTATTG TTCTCGGTGA TAGGCCTTGG CTATTGCAAT
CTGCTAGACA CAGCTTGGCA TATTCATCCA TCTCATTTCT GCCTGCTTCC CATGTGACAC CAGTGTCTTC TACTGATTGC
CCCAGTGGTC TGCTGTTTGT TTCGGAGAAC TGTTTGCATT TGGTAAGTTT CTAGGACTCG TGAAAGTGAA ATCCACAAGC
AAAACATGCA CATATTCTTT TTTAGGGATC AAGAATAATT ACATTATTGC TTGCATTTCA TGCTCTGAAT TATTAGGACT
CATAAACCAT GAGATTGCTA AAATCTGGGA TCGAATCCCA TTATAATGAG TTCTCCAAAT AGATAGTCAG GAACATAGAA
ATCATGGCTG TTGATTGTTA TCTTATAATT TTCTTTATGC ACTCGGTGAA ACCGTATTCT CTCTTCTGGC ATCAAAATTT
CACACTTCTC TTTTTTGCTG CTATTTCTTT AGTATCCGTT TCTCTTTTGC CACTATCGTT GGTCAACATC CGTTGACCAT
CACATTTGCC AATAAAAAAC TGTTGTACCC TTGCGAAACT AACAAAATAT AAGAAATTCA AACTATCTAG GAAAATACAA
TTTACCTTTT TAGTTTTTAA AGGTTGTACA AATAATTATG GTAGGAAAAT TTTCAGTTAG TTTAAAAGGT TCCCACGTGT
ATCTTAAAAA TGGAATTTTT AAAGGAAATA TTTTTGCATA TCCACATACA AATCAAACAG CATAGCTACC AATATTCATG
TAAACAACCA TGCACATAAT TCCTTAGTAT AGATTATTCT GTGAAACATT TGAGAACcaa atcattccca tgctacattt
ttaaagatta atattagtga taatataatt cccaatttta tgtttttcta aaaaaGTGTA TTAAGTGGCC ATAATTTAGT
TTTCTTGATA ACTTTATGGT ATAGGTTAAA ATGTCAAGTG CTGCATTATT TTGGAACATG TACAGGGGTA TAATGGCCTT
TTAGGGGCTA ACTTAACAGT CAATGGATGT TGACTAGACG GTAATGATGA AACAAAAATT TGCTCTGACA GAATAGTGGC
AAAAGAGAGA AGTGCAGATT TTCGATGGCG GAAGAGAGAA CACAGTTGCA ATGAGTGACA AAAAGAAAAA AAATCCCTTG
TTTTATTATA CATAGAACTA ATTTGATTCG TGACATCGAA ATGGTACTCA CAGATTTTCC ATCCATGGTT TCTCTCATAT
CATTGTATTT GAGATTTTCT TTTTGCTAGC ATATAATTTT TGAAAACtac tccctctgtc ccataataag ttcatttttg
gtttcttcta ttttccccaa aacaagttca tttttgaaga atcattgcag agtttgtgga agtaaggaat gattatttgg
gagaagataa agtgaggaat agttgcattg cgatatgata aagtagggat attctagttg tatatgtgtg ggatgggtga
aaaatgaact tatttaggga cggaaggagt aACTAGGTAA TGTCATGTAC CTTGTAGTTT TCTCTAATGG GGCATTTTAC
CAGAGGGGTG GCAATGTAGC AGAGAGTGTG TCACCATGTC AAGTAAAAAA CCCTCCCATT CTGTATTCTA TTTTCCCCAT
GGCCAAAGGG ACTTTAGTCC TTTTCTTGTT CGTCTGAAAC ATGAAATCTC TTAATCGTAG TCATCCTGTT TTAGCCTTTC
CCTGTTAAGT TTATGTGCTT ATATTTCAAG TAGATTTCTT TTGTTCCAGT CCCTTCTGTT GATCTGCCAT AAGTATGGTG
CAATTACTAG GATAATTTAT TCTAAAATAC CAAGATGATA ATAAAATCAT GACCTTGTGG GTATTGTTGA AACTTGAAAG
CAATGCTTAT ATTATTCTCT CACTATTGGT ATGCATGTAT GTGTTCTCAC ATAGTCACAT GTTTATCTCC TAAAAGTGGC
TTGCATGTGC ATTTCATTGT ACTGTCAGTT TAAATCAAGT TTATCTTTTC AGGTTGAAAT GGTTCATGGC AAAAGACTAA
ATGCACAGAA GTTTTCGATT GGAGGGACTC CAAGGAAAGT GTTATACCAC AGTGATAGTA GAACACTGTT GGTGCTGAGA
ACTGGGTTAA CCAGTGTATC CTGTTCTTCA GATATTGTTC AAATAGATCC AAGTAATGGG GCATTGCTTT CCAGATTCAA
GTGCGAACCT GGTGAAACAG CAAAATGCAT GCAAATTGCA AAGATAGGGA ATGATCAAGT ATTAATCGTT GGAACTAGTA
AGTCCAATGG CCGACCAATG ATGCCAAACG GTGAAGCAGA AAGGTAAGGA CGACAACTCA TGTTTTGTTT CTGCTGAACC
TTGTTTTGTC AAGTTTGAAG TGTCCATGGT CCCTTAGAAT TTTTGCACTA CTAATGTTTA ACTTGCAATC CTAGTGTTTT
TTTTTTGCTT GGTTTGAGTA TAATTATTAA TATTAATGAT CTGTTGTTTT GGTCTCCACT TTTTTGTTTT CTGTCTGCCC
GTTGTCTGGT ATTCTGCAAA AGTGACATGG GTATGAATTT GCAAAGCTTG CAACCATGAG GCACATTTTT TGGTTTCTCA
CTGATTGTGA CGGTGTTGCC ATTGCGCTAT TGATCATTCA ATGCATATTT GCAGTTGGAT CATCAATATT TTTTTCTTGT
TTTTTCTGCA CTTAATTTAG TTTTTCCATT TCCATATCTT TGAATTGTGT GTATAGTTAA AAGCTGCCTT TATATTGTTA
TTATAACTAT TCTCTTTGGA TGAAACAGTA TCAAGGGTCG TCTAATTCTT TTAAGCTTGG AGACTATTGA AAGTCCTCGT
GAGAGCGGTT CGTTTACTGC AGCTTCTAAT TTGAATTCAT CTCATGCTGG TTCTCCATTC CCGGAATTTG TTGGATATGC
AGCAGAGGAG CTGTCTAGTA ACAGCATGTG CAGCAGTCCT GATGAAGTTT GCTGCAATCA AATTCAACCT GAACTCATGG
CAGGCCATTT GAGATCACTA GTCCAACATA CATTCAATGG CGCTGTTCTT GCTGTACATC CATATCTAGA TAGATATGTG
TTGGCAGCAG CTGGAAATGT GGTATGATTA GAAGTCAATT TTTATCATAT ATGATAGTAT ATCTATTAAA GAGTAGCTTA
GCTCGGTAAT GGATCTAGAT AAATAAATTT GCAAAGAAGC TTGAATGCTT GATTGGCAAG TTCCGGACTC TTGACATCAG
AATCAGTTAA TCAACATTTA TCCTGGCAAA TAACACTATT TATGTGGATC GTATGGTGTT GGCTTCTTTC ACTTCTATAG
ATTGCTAGAA CAACAGAACG AAGGTGCATT AGCACTTTAG CATATGAGCC ACATTAATAG CAGAGGATTT TTTTTTGTAA
TAACTACTGG AGAGATAGAC TAGTGACGAT TGGAGTTGAG GAGATGGAGA TTGGAAGGGT TATTTGCCAT TATAAAAAAA
ATCCTGAAAG AATATCCCAA CAAGAGTGTT ATTATTTTCC AAAACAAACA GTTATCATGA CGTCACTAAA TTTTCTATCA
TTCTGTTACT ATCTGGTGCT AATATGTTGA TGCTGACAGA TCCAGTTTGA ATACCACAAT ATTTGAAAAT CATGATCTGA
GATTTTCTCT GCCTTATCTT GACAGCTTTT TGTATTTGGA TTTTTAAATG AAAGTCCCCA TCGGATAAAA AAGTATACTA
CGAGTAGGAC ACGATTTACA ATAACCTGTT TGAAGACGTA TGCATCACGG ATTGCAGTGG GTGATTGCCG CGATGGTGTT
CTCTTCTATT CTTATCATGA GGTACAAGTT GATTCAATTG AAACAATACA TTTTTATGAT GTTTATTTTT ATGGAGCTTC
TTTGTCGTTA CCTCTAATCC TCGTATTGAT TTATGCCAGA ATCTTAGGAA GTTGGAACTG ATCTATTCTG ATCCTGCCCA
ACGGCTAGTG GGTGATGTTG CCCTTTTGAG CTGTGAAACT GCTGTTGTAT CAGATCGACG AGGGAGCATA TCTGTACTGT
CTTGCCCAAG ATTAGAAGGT ATGCCTTGGT ATAGATGTCT ATGTTATCCC TTTCTTTTTA GTTTGTACCT GTTCTTTTCT
CTGGATTCTT TTTAATGGTA GTGCCTCCTC TATACTCTTC TGCATCTTGG TCATACTTTG TAATTTTGTA GCCTTCATGT
TTAGTTTCTC AATCTAATTC CTTTATTGAC ATACTAAATA TGCAGTATAA ACATCACAAT ATAGCTGGCA TAAAATTTGC
CAGTGTAGTA AGGCCACATA GTTGAATATT GTGCCTAGAA GCTTTATGAA TTTCGTAATA GAATTCAAAA TTTTGCATTA
CGTTTGTGTA CTTCTCATCA TATATGCATT ACTTTGTAAT ATCTACCTAA ATTAATTTAA ATTTTACATT ACGTCAAGAT
TTATTTTGAC TTTTTTTAAC ATATCTTGCA GTATCCGAAA GTCCAGAGAA GAACCTAGCG GTGCATTGTT CATTTTACAT
GGGTGAAACA GCTATGAGCA TCCAGAAGGT AAGCTTCTGT TGGCATCTTA GGGCTAACCA GTGTGAATTC CATTAACGAA
AACATACCAA AGAGAGGGTT TTGAACATGG GTATTGGGTA GCTGCTTTGG ATTTAAAGGA TGAATCATGT GTTTGTAACT
TGATGAACTA ATGGGCTGTT TGGTTTGAGG AATCAAATCA TCCTAGGATG AGTTTTTTCC AGCATGACCC ATCATGAgta
ggggtgaaac agtgcggaaa cggacggaaa caacctttat cgttttcgtt ttcatatttt ttttggaatc ggaaaccccg
aaaacgaata ttttcgaaac tgaaaacaga gcgaaaacga accggtgcgg atacggtaat gaaaatttat cggaatacaa
aaacccctca aactgagctt caaacttttg tcaagtctaa ttctcaagtc tcaacagtca acaattcgtc ataaaacaca
attatatcaa gtctaattgt taagtctcaa cacaagtaca caataacacT TAACACGGAG TGACGGAGGT GGAGGTTGAG
GAATAACACC TGCTGGCTGC TGCCACTGGG CTGCTGGCTG CTGCGAGGCG AGGCGTTGTC GGCGGTGAGG AAGAGTCGCC
AGTGGGGCTT GAGGTGTCGT AGACTTGTCG GTGTGGCTAT GGCGGCGTCG TCAGTGGTGG TGGCGGCGGC GAAACGGCGA
GACGGCGGCG CGAAACGGCG GGACGGCGCC GCGAGATGGT GGCGGTACGA GACGGCGGTA TGGGACAACG AAGAGCGACT
GCGAGAGAGG AAGGGTGGGC ACGGTCGCGA GGACGGCAGG GGCGAGGTCA CGAGGAGCCG AGGACGGCAG ACCAGCGGTG
GCGCGGGCGG TGGGCGCTGG GGAGCACGAT GCCGTGATCT GGATTCTGGA TGCGCTGCTC CGCCGCCGGC TCGCGGTCGC
GCGATGCCGT GCTCCCGTGC AGCGATCAGT GTGTCTCTCC TCTCTAGGGT TAGCCGCTAT TTGGGTAGAT GCTGCGATTT
GGATTGGGCT GGGAACTTGG GGACGACTTA TAGACTATTG ATTCTATGGG CCTTTTTaac ttcagaaatt ccggcaaatt
ttttggaatt tttccgaccg attccgagtt ccgacggaaa ctgctattat catattcgat ttcgtttccg agaaaatatt
tccgttttcg attccgtttc tgagaaattc tgaaaaaatt ctgaccagct gattccattt ccgaaaacag gcccggaatc
cggaaagttt ccgtaccgtt ttcaccccta ATCTTGAGGT CATCCCATGA TTTTGATGGG ATGATCCAAT GATCCCATTC
ATCTTTTTTT TTCCAACTAA GCATGTCGCT TTGAGGAATG AGGTAGAAAT TTAGTAGTCC ATTCTGCTCT TGTTTGGTTC
GGAAGTTGGA CCTGCTGGTG CATTGAGTAT CCAATTACTT AGATGAAACA GCCCATAATT GATCTAGGAG ATTTGCCTTG
TTATCTCTCA TGATCCCGTT ATTTTCCCTG AACATTTGGT TTTCATTCAT CATGACCCGA CCCTTTTCTT TCTATATGAG
CCCCATGGAG AAGTGTGACC GAACTAGTTT CATGTTTTAT ATTGTTGCTT TGCTTTCCTA TGGTTAATTC GGTCTTGTAA
TTTGCTGTAG GTTGCATTTA AGCATTGGCT TCCAATTGAT GATTTGACAG AACCAGTGTT GGAGTCGGTA TACAACTGTG
TCGTCGCAAG CACTCTGCTG GGGAGTATCT TTGTTATGAT TCCACTCACA AGGTGTAGTT TTGAAGATTC CAACTCTAGA
ATCTAAATTC ATGCTATTAG CTATTTATCT GTGACAGCTC AGTCAGGGCC ACTGCTAGCC TGTCGGTAAC ATCTAAACCA
ATTTGGGAGA TTGAATTTGC TTTAAGTTAA TCAGGGTTGT GAACTATGAT AGTTTTGGCT AAGCTTCACA ATTATATTTG
GTACATGATT TTTGAAATGT TATTCACATA AATAATAAAA TAGAACACTT TATCGTTTAG AATTATTTGT TGCTATGCTG
TTCCTGAGGA CTAGATGCCA TACACATTGA TAATGTAAAC AAAGTAGTCA ATGCTCGCAC CATTACTAAT TAAATCCAAA
TTGATTGTGT TTAACCTGAT AATTTGTTTG CGTACTAGTG TCGACAACTA ATTGGTAAAC TAAGCCCTTT CCCATTCTAT
ATCCTTTTGT AACAAGGGGC CAGAGTTATT TTATCTCTGC ACACTAGTGT TATGATTCTG AAGCTAATGA ATTGGTAATG
CAGTGAGGAG CATCAAATGT TGCAAGATGT CCAAGAAAGA CTTTCGGTTC ACCCATTGAC TGCTCCACTC TTAGGAAATG
ATCATGCAGA GTTTCGTCGC CGTGGTATCC CGGTAAGATA ATTAAACTGC CATACTGAAA GCTAGTTTTT TTTGCAAGTG
TTGAATAACC TTATACACTA CTGCTATGAC AGTCGGGAGT ACCGCCCATT CTGGATGGCG ACATGCTTGT GCAGTTCCTG
GAGCTCACCA GCGAACAACA GCACGATGTT CTCAATATTG TTTCTCCTGG AAAGAAGAGG CAACACGATA TCTCGGTTTT
CCAGGTCATG CGAGCATTAG AGAGGGTGCA TTACGCACTC AACTGAGGCG TTCAACAATC CATTCAACCC GGTCACTGTT
CTTACCGACA TGGCTGTCTC CAACCTGCTG ATATTTGGGT GGCATCATCG CTGAATTTGG ATCCGAGCCG AGCACCGAGT
TGTTGCAGCT GAAGCTGCTA CTGGAGCACA TACCCAGAAC ATACCAAATC TCAGCTGTAG TGAGGTGCTG TGTTTTGCTG
TGGGATGATA GGCCCATCTG ATGTCGCAAT AGTGTGTCAT TGCTCTAGTG CAATCTTTGT AAATAACGAA TAATATTTTG
GCAGAAGGAT GTGGATACAA ATCCTTTTGC CCAGTGAAAG GAACAACCCT CGTGAACGCA T