Os07t0203700-01

Locus

Os07g0203700

Description

Putative splicing factor 3b subunit 3 (SF3b3), Regulation of cell death and resistance responses

RAP-DB Gene Symbol Synonym(s)

SPL5, SF3b3

RAP-DB Gene Name Synonym(s)

spotted leaf 5, splicing factor 3b subunit 3

CGSNL Gene Symbol

SPL5

CGSNL Gene Name

SPOTTED LEAF 5

Oryzabase Gene Symbol Synonym(s)

spl5(bl6,spl5-1), bl6, spl5, SF3b3

Oryzabase Gene Name Synonym(s)

spotted leaf5, spotted leaf 5, spotted leaf-5, splicing factor 3b subunit 3

Transcript Evidence

KC128660

AK064566 (truncated)

AK100154 (truncated)

Protein Evidence

Q7X971

Literature

PMID: 24280096

DOI: 10.1007/s11032-011-9677-4

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

July 21, 2020

Gene Ontology (GO)

Molecular Function: nucleic acid binding (GO:0003676)

Molecular Function: protein binding (GO:0005515)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

WD40/YVTN repeat-like-containing domain superfamily (IPR015943)

Cleavage/polyadenylation specificity factor, A subunit, C-terminal (IPR004871)

Full-length cDNA

002-112-D04(truncated) (Online Clone Ordering)

J023018F09(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os07t0203700-01)

TENOR (Os07t0203800-01)

RiceXPro (AK064566)

RiceXPro (AK100154)

Others

Oryzabase (812)

KEGG (Os07t0203700-01)

KEGG (Os07t0203800-01)

Transcript

4494 bp

>Os07t0203700-01 Putative splicing factor 3b subunit 3 (SF3b3), Regulation of cell death and resistance responses
ACCTCTCCCCACCCCCAACCTCCCAAACCCTAACTCTCTCTCTCCCTCGTCGCCGGCGAA
GCTTCCAGAGGCGGGGGCAGCGCGAGCGCATGGAGTCCCCCACCGCCGGCGGGGGCGGGG
GAGGGGGCGAGGCCGGcgccgcgtcgtcgtcgtcctcctcctcgggcccctccacatcgt
ccgccgccgccgccgccaccgcatcggcatccgcgtcctcatcagccgtcgccacccgct
acctcGCCAAGCGCGTGCTCCGCGGGAGCGCCGTGCTCCACGTCGCCCAGGGCTGCTTCC
GCTCCCCCGACTGCGTCGACGTCGTTCTCTGCAAGGAAAATTCACTGGAATTGGTTGTTA
TTGGTGAAGATGGTGTTTTACAATCAATCTGTGAACAAACCACATTTGGTATTATAAAAG
ATGTTGGTGTCTTAAACTGGCGCTGTACACACTTTGGTTTAATGCCGAAGATAGAAGGGA
AAGAAATTCTGGTTATACTTTCAGATTCTGGAAAGCTATCTCTTCTTTACTTTTGTTCTG
AGATGCATAGGTTCTTTGCAATTGCAAATATTGAACTATCGAAACCAGGAAATTTGAGGC
ATCGGCTCGGGAGAATTTTAGCTATAGACCGAGAATCTAGGTTTGTTGCTGTCAGTGCAT
ATGAGGATGAGTTTGCATTTGTACGTGTTTCAGTGGATCACAAACTTCATGCTCCTAATG
GAGAAATTGAAGAGGATGCTAAAATCATCAGTACTGCATATAATACCAGCAGTATCCATG
GTACAGTTTGGAGTATGTGCTTCATATCAACATGCCTGGATGAAGAATATTATCCTGTAG
TTGCAATGATAGTTAACAGGGGCTCTGATGTAAATGACTTGGCACTCTATGGGCTAGATT
CCCATAAACGTACTATTGACCGCATATCTACTTATTTAGAAGCTGGACCTTTGGCACTTG
AAATCTCAGAAATTCCCCAACTGTATGGCTTTGCACTTATGTTTCGTGCTGGTGATGTTC
TGTTGATGGATCTGAGGAACCCAAAGGACATCAGTTGTATCCATAGAATAAGCTTGTCAA
CTAGTCTAATTGGAGATCATGTCTCCGTTGAAGATTCCTGTAGGGGATTAGATGTCGATG
ATGATGTGGCGGCTTGTGCTTTGCTGGAACTGAGAGACTCTGGAAATAACATGATGAGGG
ATGACAGTTACATGGACATTGACGGTACTGATAACAAAGCTGTAGTGAAATCAAGGATTG
TTTGCTCATGGAACTGGGAGCCAAATGCCATGCAAGGACATCCAAGGCTGATCTTTTGCT
TGGATGATGGAGAATTTCATCTTCTAGAGTTTAGTTTGGATATGGAAGGAGTGAAGGTAT
TGCCTGAGTGTGTCCATAGAGGTTTGCCTTGCAAACCTCTTTTGTGGATGGACAAAGGAA
TGGTAGTTGGATTTGTAGAGATGGGAGATGGGATGATCCTCCAACTTGAAAATAATAGAT
TGGTGCATAAAAGTGCAATTCAGAATGTAGCGCCAATATTGGATCTAGCAATTGCTGACC
ACCATGGTGAGAAGCAGGATCAGATGTTTGCATGTTGTGGAATGTGCCCTGAGGGGTCCT
TGCGAGTAATACGTAATGGTGTCAATGTGGAGAAACTTCTGAGGACAGATCCTATTTATC
ATGGTGTTACTGGTTTGTGGACCTTGAGAATGAAGAGAACTGATGCTTATCACTCTTTTC
TTGTATTGTCATTCGTTGAGGAAACCAGAATACTATCAGTAGGACTCAGTTTTAATGACA
TCTGTGATGCTGTAGGATTTCAGACTGATGTTTGCACTCTGGCATGTGGTTTAGTAGCTG
ATGGTTTGCTTGTGCAAATTCACAGCAAATGTGTAAAGCTTTGTTTACCTACAGCATGTG
CTCACCCTGAGGGAACTTTGCTCCCGTCTCCTGTTTGTGCTGACTGGTATCCTGATGTCA
CTATCAGTGTTGGTGCTGTTGGACATAATGTTGTTGTTGTTGCTACATCGAATCCTTGTT
GCCTTTACATACTTGGGGTCAGATCATTATCTTCGTTTCAGTATGAGCTGTATGAGATAC
AACATGTCCAGTTGCATTATGAAGTATCTTGCATATCTATTCCACAAGAGGACTGGAGAC
TTGATAATTCATCTTCTAGTTGTGCAACGAGTGGTGATTTTCGGAAAGATTTTGCAGCTA
ATATTCGCAAGTTTGCTGTAATTGGAACTCACGAACCTTCTGTGCATATCATTTCGTTGG
AACCTGGAGAAGCATTTCAGCAACTTGCTGTTGGGCATATATCAGTAAACAACGCGCTCG
GCACTCCTATCAGTGGTTGTATACCTGAAAATGTTAGGTTTGTAGCAGCTGCAAGGTTCT
ACATTCTTGCAGGACTAAGGAATGGAATGCTACTGAGGTTTGAGTCACAAACAAGCAAAG
GGCATTGTTTCCCTGGTTCCTTTTACAAGGAGTCCTCTACCCCTTGTGATGATACATCCC
TTATGTTGATTGCTGTACGGCGTATTGGAATCACTCCTGTAGTTTTGGTACCGTTGCATG
ACAGAGCCAATGCTGACATTATTGTTCTCGGTGATAGGCCTTGGCTATTGCAATCTGCTA
GACACAGCTTGGCATATTCATCCATCTCATTTCTGCCTGCTTCCCATGTGACACCAGTGT
CTTCTACTGATTGCCCCAGTGGTCTGCTGTTTGTTTCGGAGAACTGTTTGCATTTGGTTG
AAATGGTTCATGGCAAAAGACTAAATGCACAGAAGTTTTCGATTGGAGGGACTCCAAGGA
AAGTGTTATACCACAGTGATAGTAGAACACTGTTGGTGCTGAGAACTGGGTTAACCAGTG
TATCCTGTTCTTCAGATATTGTTCAAATAGATCCAAGTAATGGGGCATTGCTTTCCAGAT
TCAAGTGCGAACCTGGTGAAACAGCAAAATGCATGCAAATTGCAAAGATAGGGAATGATC
AAGTATTAATCGTTGGAACTAGTAAGTCCAATGGCCGACCAATGATGCCAAACGGTGAAG
CAGAAAGTATCAAGGGTCGTCTAATTCTTTTAAGCTTGGAGACTATTGAAAGTCCTCGTG
AGAGCGGTTCGTTTACTGCAGCTTCTAATTTGAATTCATCTCATGCTGGTTCTCCATTCC
CGGAATTTGTTGGATATGCAGCAGAGGAGCTGTCTAGTAACAGCATGTGCAGCAGTCCTG
ATGAAGTTTGCTGCAATCAAATTCAACCTGAACTCATGGCAGGCCATTTGAGATCACTAG
TCCAACATACATTCAATGGCGCTGTTCTTGCTGTACATCCATATCTAGATAGATATGTGT
TGGCAGCAGCTGGAAATGTGCTTTTTGTATTTGGATTTTTAAATGAAAGTCCCCATCGGA
TAAAAAAGTATACTACGAGTAGGACACGATTTACAATAACCTGTTTGAAGACGTATGCAT
CACGGATTGCAGTGGGTGATTGCCGCGATGGTGTTCTCTTCTATTCTTATCATGAGAATC
TTAGGAAGTTGGAACTGATCTATTCTGATCCTGCCCAACGGCTAGTGGGTGATGTTGCCC
TTTTGAGCTGTGAAACTGCTGTTGTATCAGATCGACGAGGGAGCATATCTGTACTGTCTT
GCCCAAGATTAGAAGTATCCGAAAGTCCAGAGAAGAACCTAGCGGTGCATTGTTCATTTT
ACATGGGTGAAACAGCTATGAGCATCCAGAAGGTTGCATTTAAGCATTGGCTTCCAATTG
ATGATTTGACAGAACCAGTGTTGGAGTCGGTATACAACTGTGTCGTCGCAAGCACTCTGC
TGGGGAGTATCTTTGTTATGATTCCACTCACAAGTGAGGAGCATCAAATGTTGCAAGATG
TCCAAGAAAGACTTTCGGTTCACCCATTGACTGCTCCACTCTTAGGAAATGATCATGCAG
AGTTTCGTCGCCGTGGTATCCCGTCGGGAGTACCGCCCATTCTGGATGGCGACATGCTTG
TGCAGTTCCTGGAGCTCACCAGCGAACAACAGCACGATGTTCTCAATATTGTTTCTCCTG
GAAAGAAGAGGCAACACGATATCTCGGTTTTCCAGGTCATGCGAGCATTAGAGAGGGTGC
ATTACGCACTCAACTGAGGCGTTCAACAATCCATTCAACCCGGTCACTGTTCTTACCGAC
ATGGCTGTCTCCAACCTGCTGATATTTGGGTGGCATCATCGCTGAATTTGGATCCGAGCC
GAGCACCGAGTTGTTGCAGCTGAAGCTGCTACTGGAGCACATACCCAGAACATACCAAAT
CTCAGCTGTAGTGAGGTGCTGTGTTTTGCTGTGGGATGATAGGCCCATCTGATGTCGCAA
TAGTGTGTCATTGCTCTAGTGCAATCTTTGTAAATAACGAATAATATTTTGGCAGAAGGA
TGTGGATACAAATCCTTTTGCCCAGTGAAAGGAACAACCCTCGTGAACGCATAA

CDS

4068 bp

>Os07t0203700-01 Putative splicing factor 3b subunit 3 (SF3b3), Regulation of cell death and resistance responses
ATGGAGTCCCCCACCGCCGGCGGGGGCGGGGGAGGGGGCGAGGCCGGcgccgcgtcgtcg
tcgtcctcctcctcgggcccctccacatcgtccgccgccgccgccgccaccgcatcggca
tccgcgtcctcatcagccgtcgccacccgctacctcGCCAAGCGCGTGCTCCGCGGGAGC
GCCGTGCTCCACGTCGCCCAGGGCTGCTTCCGCTCCCCCGACTGCGTCGACGTCGTTCTC
TGCAAGGAAAATTCACTGGAATTGGTTGTTATTGGTGAAGATGGTGTTTTACAATCAATC
TGTGAACAAACCACATTTGGTATTATAAAAGATGTTGGTGTCTTAAACTGGCGCTGTACA
CACTTTGGTTTAATGCCGAAGATAGAAGGGAAAGAAATTCTGGTTATACTTTCAGATTCT
GGAAAGCTATCTCTTCTTTACTTTTGTTCTGAGATGCATAGGTTCTTTGCAATTGCAAAT
ATTGAACTATCGAAACCAGGAAATTTGAGGCATCGGCTCGGGAGAATTTTAGCTATAGAC
CGAGAATCTAGGTTTGTTGCTGTCAGTGCATATGAGGATGAGTTTGCATTTGTACGTGTT
TCAGTGGATCACAAACTTCATGCTCCTAATGGAGAAATTGAAGAGGATGCTAAAATCATC
AGTACTGCATATAATACCAGCAGTATCCATGGTACAGTTTGGAGTATGTGCTTCATATCA
ACATGCCTGGATGAAGAATATTATCCTGTAGTTGCAATGATAGTTAACAGGGGCTCTGAT
GTAAATGACTTGGCACTCTATGGGCTAGATTCCCATAAACGTACTATTGACCGCATATCT
ACTTATTTAGAAGCTGGACCTTTGGCACTTGAAATCTCAGAAATTCCCCAACTGTATGGC
TTTGCACTTATGTTTCGTGCTGGTGATGTTCTGTTGATGGATCTGAGGAACCCAAAGGAC
ATCAGTTGTATCCATAGAATAAGCTTGTCAACTAGTCTAATTGGAGATCATGTCTCCGTT
GAAGATTCCTGTAGGGGATTAGATGTCGATGATGATGTGGCGGCTTGTGCTTTGCTGGAA
CTGAGAGACTCTGGAAATAACATGATGAGGGATGACAGTTACATGGACATTGACGGTACT
GATAACAAAGCTGTAGTGAAATCAAGGATTGTTTGCTCATGGAACTGGGAGCCAAATGCC
ATGCAAGGACATCCAAGGCTGATCTTTTGCTTGGATGATGGAGAATTTCATCTTCTAGAG
TTTAGTTTGGATATGGAAGGAGTGAAGGTATTGCCTGAGTGTGTCCATAGAGGTTTGCCT
TGCAAACCTCTTTTGTGGATGGACAAAGGAATGGTAGTTGGATTTGTAGAGATGGGAGAT
GGGATGATCCTCCAACTTGAAAATAATAGATTGGTGCATAAAAGTGCAATTCAGAATGTA
GCGCCAATATTGGATCTAGCAATTGCTGACCACCATGGTGAGAAGCAGGATCAGATGTTT
GCATGTTGTGGAATGTGCCCTGAGGGGTCCTTGCGAGTAATACGTAATGGTGTCAATGTG
GAGAAACTTCTGAGGACAGATCCTATTTATCATGGTGTTACTGGTTTGTGGACCTTGAGA
ATGAAGAGAACTGATGCTTATCACTCTTTTCTTGTATTGTCATTCGTTGAGGAAACCAGA
ATACTATCAGTAGGACTCAGTTTTAATGACATCTGTGATGCTGTAGGATTTCAGACTGAT
GTTTGCACTCTGGCATGTGGTTTAGTAGCTGATGGTTTGCTTGTGCAAATTCACAGCAAA
TGTGTAAAGCTTTGTTTACCTACAGCATGTGCTCACCCTGAGGGAACTTTGCTCCCGTCT
CCTGTTTGTGCTGACTGGTATCCTGATGTCACTATCAGTGTTGGTGCTGTTGGACATAAT
GTTGTTGTTGTTGCTACATCGAATCCTTGTTGCCTTTACATACTTGGGGTCAGATCATTA
TCTTCGTTTCAGTATGAGCTGTATGAGATACAACATGTCCAGTTGCATTATGAAGTATCT
TGCATATCTATTCCACAAGAGGACTGGAGACTTGATAATTCATCTTCTAGTTGTGCAACG
AGTGGTGATTTTCGGAAAGATTTTGCAGCTAATATTCGCAAGTTTGCTGTAATTGGAACT
CACGAACCTTCTGTGCATATCATTTCGTTGGAACCTGGAGAAGCATTTCAGCAACTTGCT
GTTGGGCATATATCAGTAAACAACGCGCTCGGCACTCCTATCAGTGGTTGTATACCTGAA
AATGTTAGGTTTGTAGCAGCTGCAAGGTTCTACATTCTTGCAGGACTAAGGAATGGAATG
CTACTGAGGTTTGAGTCACAAACAAGCAAAGGGCATTGTTTCCCTGGTTCCTTTTACAAG
GAGTCCTCTACCCCTTGTGATGATACATCCCTTATGTTGATTGCTGTACGGCGTATTGGA
ATCACTCCTGTAGTTTTGGTACCGTTGCATGACAGAGCCAATGCTGACATTATTGTTCTC
GGTGATAGGCCTTGGCTATTGCAATCTGCTAGACACAGCTTGGCATATTCATCCATCTCA
TTTCTGCCTGCTTCCCATGTGACACCAGTGTCTTCTACTGATTGCCCCAGTGGTCTGCTG
TTTGTTTCGGAGAACTGTTTGCATTTGGTTGAAATGGTTCATGGCAAAAGACTAAATGCA
CAGAAGTTTTCGATTGGAGGGACTCCAAGGAAAGTGTTATACCACAGTGATAGTAGAACA
CTGTTGGTGCTGAGAACTGGGTTAACCAGTGTATCCTGTTCTTCAGATATTGTTCAAATA
GATCCAAGTAATGGGGCATTGCTTTCCAGATTCAAGTGCGAACCTGGTGAAACAGCAAAA
TGCATGCAAATTGCAAAGATAGGGAATGATCAAGTATTAATCGTTGGAACTAGTAAGTCC
AATGGCCGACCAATGATGCCAAACGGTGAAGCAGAAAGTATCAAGGGTCGTCTAATTCTT
TTAAGCTTGGAGACTATTGAAAGTCCTCGTGAGAGCGGTTCGTTTACTGCAGCTTCTAAT
TTGAATTCATCTCATGCTGGTTCTCCATTCCCGGAATTTGTTGGATATGCAGCAGAGGAG
CTGTCTAGTAACAGCATGTGCAGCAGTCCTGATGAAGTTTGCTGCAATCAAATTCAACCT
GAACTCATGGCAGGCCATTTGAGATCACTAGTCCAACATACATTCAATGGCGCTGTTCTT
GCTGTACATCCATATCTAGATAGATATGTGTTGGCAGCAGCTGGAAATGTGCTTTTTGTA
TTTGGATTTTTAAATGAAAGTCCCCATCGGATAAAAAAGTATACTACGAGTAGGACACGA
TTTACAATAACCTGTTTGAAGACGTATGCATCACGGATTGCAGTGGGTGATTGCCGCGAT
GGTGTTCTCTTCTATTCTTATCATGAGAATCTTAGGAAGTTGGAACTGATCTATTCTGAT
CCTGCCCAACGGCTAGTGGGTGATGTTGCCCTTTTGAGCTGTGAAACTGCTGTTGTATCA
GATCGACGAGGGAGCATATCTGTACTGTCTTGCCCAAGATTAGAAGTATCCGAAAGTCCA
GAGAAGAACCTAGCGGTGCATTGTTCATTTTACATGGGTGAAACAGCTATGAGCATCCAG
AAGGTTGCATTTAAGCATTGGCTTCCAATTGATGATTTGACAGAACCAGTGTTGGAGTCG
GTATACAACTGTGTCGTCGCAAGCACTCTGCTGGGGAGTATCTTTGTTATGATTCCACTC
ACAAGTGAGGAGCATCAAATGTTGCAAGATGTCCAAGAAAGACTTTCGGTTCACCCATTG
ACTGCTCCACTCTTAGGAAATGATCATGCAGAGTTTCGTCGCCGTGGTATCCCGTCGGGA
GTACCGCCCATTCTGGATGGCGACATGCTTGTGCAGTTCCTGGAGCTCACCAGCGAACAA
CAGCACGATGTTCTCAATATTGTTTCTCCTGGAAAGAAGAGGCAACACGATATCTCGGTT
TTCCAGGTCATGCGAGCATTAGAGAGGGTGCATTACGCACTCAACTGA

Protein

1356 aa

>Os07t0203700-01 Putative splicing factor 3b subunit 3 (SF3b3), Regulation of cell death and resistance responses
MESPTAGGGGGGGEAGAASSSSSSSGPSTSSAAAAATASASASSSAVATRYLAKRVLRGS
AVLHVAQGCFRSPDCVDVVLCKENSLELVVIGEDGVLQSICEQTTFGIIKDVGVLNWRCT
HFGLMPKIEGKEILVILSDSGKLSLLYFCSEMHRFFAIANIELSKPGNLRHRLGRILAID
RESRFVAVSAYEDEFAFVRVSVDHKLHAPNGEIEEDAKIISTAYNTSSIHGTVWSMCFIS
TCLDEEYYPVVAMIVNRGSDVNDLALYGLDSHKRTIDRISTYLEAGPLALEISEIPQLYG
FALMFRAGDVLLMDLRNPKDISCIHRISLSTSLIGDHVSVEDSCRGLDVDDDVAACALLE
LRDSGNNMMRDDSYMDIDGTDNKAVVKSRIVCSWNWEPNAMQGHPRLIFCLDDGEFHLLE
FSLDMEGVKVLPECVHRGLPCKPLLWMDKGMVVGFVEMGDGMILQLENNRLVHKSAIQNV
APILDLAIADHHGEKQDQMFACCGMCPEGSLRVIRNGVNVEKLLRTDPIYHGVTGLWTLR
MKRTDAYHSFLVLSFVEETRILSVGLSFNDICDAVGFQTDVCTLACGLVADGLLVQIHSK
CVKLCLPTACAHPEGTLLPSPVCADWYPDVTISVGAVGHNVVVVATSNPCCLYILGVRSL
SSFQYELYEIQHVQLHYEVSCISIPQEDWRLDNSSSSCATSGDFRKDFAANIRKFAVIGT
HEPSVHIISLEPGEAFQQLAVGHISVNNALGTPISGCIPENVRFVAAARFYILAGLRNGM
LLRFESQTSKGHCFPGSFYKESSTPCDDTSLMLIAVRRIGITPVVLVPLHDRANADIIVL
GDRPWLLQSARHSLAYSSISFLPASHVTPVSSTDCPSGLLFVSENCLHLVEMVHGKRLNA
QKFSIGGTPRKVLYHSDSRTLLVLRTGLTSVSCSSDIVQIDPSNGALLSRFKCEPGETAK
CMQIAKIGNDQVLIVGTSKSNGRPMMPNGEAESIKGRLILLSLETIESPRESGSFTAASN
LNSSHAGSPFPEFVGYAAEELSSNSMCSSPDEVCCNQIQPELMAGHLRSLVQHTFNGAVL
AVHPYLDRYVLAAAGNVLFVFGFLNESPHRIKKYTTSRTRFTITCLKTYASRIAVGDCRD
GVLFYSYHENLRKLELIYSDPAQRLVGDVALLSCETAVVSDRRGSISVLSCPRLEVSESP
EKNLAVHCSFYMGETAMSIQKVAFKHWLPIDDLTEPVLESVYNCVVASTLLGSIFVMIPL
TSEEHQMLQDVQERLSVHPLTAPLLGNDHAEFRRRGIPSGVPPILDGDMLVQFLELTSEQ
QHDVLNIVSPGKKRQHDISVFQVMRALERVHYALN*

5'UTR

chr07:5580434..5580522 (- strand) : 89 bp

CDS

chr07:5580188..5580433 (- strand) : 246 bp

chr07:5579160..5579294 (- strand) : 135 bp

chr07:5578960..5579039 (- strand) : 80 bp

chr07:5578272..5578355 (- strand) : 84 bp

chr07:5577367..5577455 (- strand) : 89 bp

chr07:5577087..5577222 (- strand) : 136 bp

chr07:5575093..5576989 (- strand) : 1897 bp

chr07:5572932..5573242 (- strand) : 311 bp

chr07:5572154..5572466 (- strand) : 313 bp

chr07:5571434..5571589 (- strand) : 156 bp

chr07:5571197..5571335 (- strand) : 139 bp

chr07:5570707..5570783 (- strand) : 77 bp

chr07:5568923..5569044 (- strand) : 122 bp

chr07:5568303..5568411 (- strand) : 109 bp

chr07:5568049..5568222 (- strand) : 174 bp

3'UTR

chr07:5567712..5568048 (- strand) : 337 bp

FASTA

>Os07t0203700-01 class=Sequence position=chr07:5567712..5580522 (- strand)
ACCTCTCCCC ACCCCCAACC TCCCAAACCC TAACTCTCTC TCTCCCTCGT CGCCGGCGAA GCTTCCAGAG GCGGGGGCAG
CGCGAGCGCA TGGAGTCCCC CACCGCCGGC GGGGGCGGGG GAGGGGGCGA GGCCGGcgcc gcgtcgtcgt cgtcctcctc
ctcgggcccc tccacatcgt ccgccgccgc cgccgccacc gcatcggcat ccgcgtcctc atcagccgtc gccacccgct
acctcGCCAA GCGCGTGCTC CGCGGGAGCG CCGTGCTCCA CGTCGCCCAG GGCTGCTTCC GCTCCCCCGA CTGCGTCGAC
GTCGTTCTCT GCAAGGTCGG GAAACACCCC CCCGCTTCCC GCACTCCCAT TCCCCTGATC GGCGAATCGT GTAGGGCTTC
CGATCGCCGT GCGTAGAGGA TGGACCCCCA AGGGTGGCTG GGTTTTTTTT TTTTTTTTTT AATTTTATGG TCGGCTCGGA
GCGTCGGGGA TGATGCTCCT TATGCCATAG ATCATGCGGT TGTTATTCGG TTTGGAGGTC CGGTCTGGGG TAACCATGGT
TGCTCTGCTT TTAGTGGTGT AAGGACATGG AGGACATGTT GCCCCAGTGA TTGGAATTGC TAAACCCAAA TATTGCTGTC
ATGCTACCGA TTGGGTTGTT GAAGCTAGCG TCGGATCAGT TCCATTAGGA GAATAATAAA TGAATAATTC AAAACATTTG
CTACACCGTC ATCTATGCCT GGATGTCCCT TTGTTTTACC ATATTTGAAT AAATTTGTGT GCCATGCTGG TAGAAGAAAC
AGAATGCGGG ACGATGGGAA AAGATAAATG AAAAGCTATA GACTTGTATC ACTGCGTATA TTGAGTGAGC TGCTTAAATT
CTTACACTCT GCTTGTTTGA TCTATGGTTG ATAAGCCGTG GGAAAATGAA ATAAGCaacc aaaaataatt tgtgggctaa
acttttatat ctgtgttctt cgcggtttaa aagtcaatgc tggtaattaa actacgatga aaaaaaccct caaaatcaac
tctaaaattc aaatttggct gcggctgata agACAACAAG CAGACGACGA GAGGAACATG AATACATATC AATTAACATG
TGAACTCACT GTATGATCTC TGTTACAAGG CTGCTGGGTT AGTTCTGCAG AATCCTGGTA CTTATTTTTC TTTCATCCTT
TTATTGAAAA TATTGGTTAT TGCTGCAGGA AAATTCACTG GAATTGGTTG TTATTGGTGA AGATGGTGTT TTACAATCAA
TCTGTGAACA AACCACATTT GGTATTATAA AAGATGTTGG TGTCTTAAAC TGGCGCTGTA CACACTTTGG TTTAATGCCG
AAGGTGCAGT TCTTTCTCAT AGCAAAGCAT AATACTTTGC AATACTTTTC CTGTGCATAT GGCTGTCTCT ACTTTTCTTC
TGATGACAGA TGGGAAGATA ATTATTTGCC ATATTCTTTT CAGATAGAAG GGAAAGAAAT TCTGGTTATA CTTTCAGATT
CTGGAAAGCT ATCTCTTCTT TACTTTTGTT CTGAGATGCA TAGGTCAGTG CTGCTCCTTT CTTATTTGTG GCATTTTTTT
CTATCTTCAC AGATCAAGCT GCTTGTATAA ACTCAAGACC CAAAAATATA ATTAATAATG ATCCAAAGTA TTAAGTACTG
TAATAGCCTA ATGATTACAT GCAACCAGAG GAAACAGTGA GAAATTTAAA AAAATGGAAA GGATGCCATT TTTTTTATGC
CTATCACATC ACACTTGTAT AGGATGTGTA TCACTTTTAA CATCCAACTC GTGTGATTGT GTCGAAATTG CCACTAGAAA
GTTATTAAAA TCTGGAAACA CATGCATATT AGACTACCGA GAATTGAAGT GAATTGCACT GCTTTTTATC ACTAATAACT
AAGCTCAGTT GTACACATTT TATTTTTTTT AATATACTGT GTTTTTCACA GTGAGAACAA AGAGCAGGAT AATATTTTTT
TGTAAGGTTC ATTATTCACG GAAGAATATT GTTTGCAGGT TTATCTTGTG CGTGGCATTT TCATTCTGCA GTTGTTATCC
TGTTTTGTTT GAGATTTACA AGATTTGCTT TGATATATTG CCCCAAAAAT AACTGTTGAC ACAGCATTTT GTATCAATTT
ATTGTAGGTT CTTTGCAATT GCAAATATTG AACTATCGAA ACCAGGAAAT TTGAGGCATC GGCTCGGGAG AATTTTAGCT
ATAGACCGAG AGTGAGTGAA AGTTCCTCTC TCTTGAAGTG TTTGTTTACA TAAAGCTTCA TTTGTTACAT GATAGAATAG
TCTCCATTAT TTTTATCATT AGTTGGTGAT ACATTAATTG TTGTACTACA TGGCAACCAA AATTGATATA TTAATTGCTG
GACTGTGTTC TTGTAAATGG GTGCAATTTC AGTGTCTTAT AGGGAGAAAT ATGAAAAATG GCATGGTATT TCAGCAAACG
GCATGAACAA TGGATGTCCA ATAGTAATGT TTCCCTTGAT TATGTGGCAT TAAGAAAGTT AAATCTTTCC TGTTGGTGAC
TGTACTCTCT GCTCATGTCT GATGTCTGAT GGTTGACAGT TGATGCTTAT GTTCGCTTTG AACAAAATGG AGCTGTCACC
GTTTCTCTAT TCCTGATTTC AAGTTTGCAA CACCCAGGTT ATTAGTTTAT GGGAATGTCT TTCATCAAAG TGCTATTAGA
TCTAATCCAT GGACACAACT AAACTGTAGA ACTTAGTGTT TGAATACTCT GGGAGGCCTG TCTAGTTTGA ATGATTATGA
ACTTGTGGTC TTGATTGACA ATTATTTGTT ACTATCTCTG TCACAAAATA ACCACAATTC TAGGAGTAGT AGTTACAATT
TTTCTTTTGT TGCGTAATCT TTTAGGTGTA TATGATAATA TGATATCGTA AACTGCATTA TAGTTGTCCA ACGCAATACT
CTAATACAAC CTTTTACATT ATAATTGCTT GATGTGTAAA TAACCTTTTT GAGGACTTAA AGTTAAATGG TTTATGAAGT
TTCTTAACTT TGGTTGTCTC TTGTCAGATC TAGGTTTGTT GCTGTCAGTG CATATGAGGA TGAGTTTGCA TTTGTACGTG
TTTCAGTGGA TCACAAACTT CATGCTCCTA ATGGAGGTAA AATTTCTGAG GTGACTCTTG AACGTAAACA ATGCCTTTTG
TGACTCTCAT TGCTTATGCT TAGTATAATA CTTACAGTAC ATTGTTCCAG ACTTTGAAGA TTTCCCATGT CATAATTTCA
GAAATATTTT TATCCACCAG AAATTGAAGA GGATGCTAAA ATCATCAGTA CTGCATATAA TACCAGCAGT ATCCATGGTA
CAGTTTGGAG TATGTGCTTC ATATCAACAT GCCTGGATGA AGAATATTAT CCTGTAGTTG CAATGATAGT TAACAGGTTT
GCTCCAAAAT CATATTCAAT AGAGCTGCTA CTTAAGTTTG TGGCGATTAC CTGGCATTCT AATTTATATT CTGAAATATC
TTTGTTTCAA CAGGGGCTCT GATGTAAATG ACTTGGCACT CTATGGGCTA GATTCCCATA AACGTACTAT TGACCGCATA
TCTACTTATT TAGAAGCTGG ACCTTTGGCA CTTGAAATCT CAGAAATTCC CCAACTGTAT GGCTTTGCAC TTATGTTTCG
TGCTGGTGAT GTTCTGTTGA TGGATCTGAG GAACCCAAAG GACATCAGTT GTATCCATAG AATAAGCTTG TCAACTAGTC
TAATTGGAGA TCATGTCTCC GTTGAAGATT CCTGTAGGGG ATTAGATGTC GATGATGATG TGGCGGCTTG TGCTTTGCTG
GAACTGAGAG ACTCTGGAAA TAACATGATG AGGGATGACA GTTACATGGA CATTGACGGT ACTGATAACA AAGCTGTAGT
GAAATCAAGG ATTGTTTGCT CATGGAACTG GGAGCCAAAT GCCATGCAAG GACATCCAAG GCTGATCTTT TGCTTGGATG
ATGGAGAATT TCATCTTCTA GAGTTTAGTT TGGATATGGA AGGAGTGAAG GTATTGCCTG AGTGTGTCCA TAGAGGTTTG
CCTTGCAAAC CTCTTTTGTG GATGGACAAA GGAATGGTAG TTGGATTTGT AGAGATGGGA GATGGGATGA TCCTCCAACT
TGAAAATAAT AGATTGGTGC ATAAAAGTGC AATTCAGAAT GTAGCGCCAA TATTGGATCT AGCAATTGCT GACCACCATG
GTGAGAAGCA GGATCAGATG TTTGCATGTT GTGGAATGTG CCCTGAGGGG TCCTTGCGAG TAATACGTAA TGGTGTCAAT
GTGGAGAAAC TTCTGAGGAC AGATCCTATT TATCATGGTG TTACTGGTTT GTGGACCTTG AGAATGAAGA GAACTGATGC
TTATCACTCT TTTCTTGTAT TGTCATTCGT TGAGGAAACC AGAATACTAT CAGTAGGACT CAGTTTTAAT GACATCTGTG
ATGCTGTAGG ATTTCAGACT GATGTTTGCA CTCTGGCATG TGGTTTAGTA GCTGATGGTT TGCTTGTGCA AATTCACAGC
AAATGTGTAA AGCTTTGTTT ACCTACAGCA TGTGCTCACC CTGAGGGAAC TTTGCTCCCG TCTCCTGTTT GTGCTGACTG
GTATCCTGAT GTCACTATCA GTGTTGGTGC TGTTGGACAT AATGTTGTTG TTGTTGCTAC ATCGAATCCT TGTTGCCTTT
ACATACTTGG GGTCAGATCA TTATCTTCGT TTCAGTATGA GCTGTATGAG ATACAACATG TCCAGTTGCA TTATGAAGTA
TCTTGCATAT CTATTCCACA AGAGGACTGG AGACTTGATA ATTCATCTTC TAGTTGTGCA ACGAGTGGTG ATTTTCGGAA
AGATTTTGCA GCTAATATTC GCAAGTTTGC TGTAATTGGA ACTCACGAAC CTTCTGTGCA TATCATTTCG TTGGAACCTG
GAGAAGCATT TCAGCAACTT GCTGTTGGGC ATATATCAGT AAACAACGCG CTCGGCACTC CTATCAGTGG TTGTATACCT
GAAAATGTTA GGTTTGTAGC AGCTGCAAGG TTCTACATTC TTGCAGGACT AAGGAATGGA ATGCTACTGA GGTTTGAGTC
ACAAACAAGC AAAGGGCATT GTTTCCCTGG TTCCTTTTAC AAGGAGTCCT CTACCCCTTG TGATGATACA TCCCTTATGT
TGATTGCTGT ACGGCGTATT GGAATCACTC CTGTAGTTTT GGTACCGTTG CATGACAGAG CCAATGCTGA CATTATTGTT
CTCGGTGATA GGCCTTGGCT ATTGCAATCT GCTAGACACA GCTTGGCATA TTCATCCATC TCATTTCTGC CTGCTTCCCA
TGTGACACCA GTGTCTTCTA CTGATTGCCC CAGTGGTCTG CTGTTTGTTT CGGAGAACTG TTTGCATTTG GTAAGTTTCT
AGGACTCGTG AAAGTGAAAT CCACAAGCAA AACATGCACA TATTCTTTTT TAGGGATCAA GAATAATTAC ATTATTGCTT
GCATTTCATG CTCTGAATTA TTAGGACTCA TAAACCATGA GATTGCTAAA ATCTGGGATC GAATCCCATT ATAATGAGTT
CTCCAAATAG ATAGTCAGGA ACATAGAAAT CATGGCTGTT GATTGTTATC TTATAATTTT CTTTATGCAC TCGGTGAAAC
CGTATTCTCT CTTCTGGCAT CAAAATTTCA CACTTCTCTT TTTTGCTGCT ATTTCTTTAG TATCCGTTTC TCTTTTGCCA
CTATCGTTGG TCAACATCCG TTGACCATCA CATTTGCCAA TAAAAAACTG TTGTACCCTT GCGAAACTAA CAAAATATAA
GAAATTCAAA CTATCTAGGA AAATACAATT TACCTTTTTA GTTTTTAAAG GTTGTACAAA TAATTATGGT AGGAAAATTT
TCAGTTAGTT TAAAAGGTTC CCACGTGTAT CTTAAAAATG GAATTTTTAA AGGAAATATT TTTGCATATC CACATACAAA
TCAAACAGCA TAGCTACCAA TATTCATGTA AACAACCATG CACATAATTC CTTAGTATAG ATTATTCTGT GAAACATTTG
AGAACcaaat cattcccatg ctacattttt aaagattaat attagtgata atataattcc caattttatg tttttctaaa
aaaGTGTATT AAGTGGCCAT AATTTAGTTT TCTTGATAAC TTTATGGTAT AGGTTAAAAT GTCAAGTGCT GCATTATTTT
GGAACATGTA CAGGGGTATA ATGGCCTTTT AGGGGCTAAC TTAACAGTCA ATGGATGTTG ACTAGACGGT AATGATGAAA
CAAAAATTTG CTCTGACAGA ATAGTGGCAA AAGAGAGAAG TGCAGATTTT CGATGGCGGA AGAGAGAACA CAGTTGCAAT
GAGTGACAAA AAGAAAAAAA ATCCCTTGTT TTATTATACA TAGAACTAAT TTGATTCGTG ACATCGAAAT GGTACTCACA
GATTTTCCAT CCATGGTTTC TCTCATATCA TTGTATTTGA GATTTTCTTT TTGCTAGCAT ATAATTTTTG AAAACtactc
cctctgtccc ataataagtt catttttggt ttcttctatt ttccccaaaa caagttcatt tttgaagaat cattgcagag
tttgtggaag taaggaatga ttatttggga gaagataaag tgaggaatag ttgcattgcg atatgataaa gtagggatat
tctagttgta tatgtgtggg atgggtgaaa aatgaactta tttagggacg gaaggagtaA CTAGGTAATG TCATGTACCT
TGTAGTTTTC TCTAATGGGG CATTTTACCA GAGGGGTGGC AATGTAGCAG AGAGTGTGTC ACCATGTCAA GTAAAAAACC
CTCCCATTCT GTATTCTATT TTCCCCATGG CCAAAGGGAC TTTAGTCCTT TTCTTGTTCG TCTGAAACAT GAAATCTCTT
AATCGTAGTC ATCCTGTTTT AGCCTTTCCC TGTTAAGTTT ATGTGCTTAT ATTTCAAGTA GATTTCTTTT GTTCCAGTCC
CTTCTGTTGA TCTGCCATAA GTATGGTGCA ATTACTAGGA TAATTTATTC TAAAATACCA AGATGATAAT AAAATCATGA
CCTTGTGGGT ATTGTTGAAA CTTGAAAGCA ATGCTTATAT TATTCTCTCA CTATTGGTAT GCATGTATGT GTTCTCACAT
AGTCACATGT TTATCTCCTA AAAGTGGCTT GCATGTGCAT TTCATTGTAC TGTCAGTTTA AATCAAGTTT ATCTTTTCAG
GTTGAAATGG TTCATGGCAA AAGACTAAAT GCACAGAAGT TTTCGATTGG AGGGACTCCA AGGAAAGTGT TATACCACAG
TGATAGTAGA ACACTGTTGG TGCTGAGAAC TGGGTTAACC AGTGTATCCT GTTCTTCAGA TATTGTTCAA ATAGATCCAA
GTAATGGGGC ATTGCTTTCC AGATTCAAGT GCGAACCTGG TGAAACAGCA AAATGCATGC AAATTGCAAA GATAGGGAAT
GATCAAGTAT TAATCGTTGG AACTAGTAAG TCCAATGGCC GACCAATGAT GCCAAACGGT GAAGCAGAAA GGTAAGGACG
ACAACTCATG TTTTGTTTCT GCTGAACCTT GTTTTGTCAA GTTTGAAGTG TCCATGGTCC CTTAGAATTT TTGCACTACT
AATGTTTAAC TTGCAATCCT AGTGTTTTTT TTTTGCTTGG TTTGAGTATA ATTATTAATA TTAATGATCT GTTGTTTTGG
TCTCCACTTT TTTGTTTTCT GTCTGCCCGT TGTCTGGTAT TCTGCAAAAG TGACATGGGT ATGAATTTGC AAAGCTTGCA
ACCATGAGGC ACATTTTTTG GTTTCTCACT GATTGTGACG GTGTTGCCAT TGCGCTATTG ATCATTCAAT GCATATTTGC
AGTTGGATCA TCAATATTTT TTTCTTGTTT TTTCTGCACT TAATTTAGTT TTTCCATTTC CATATCTTTG AATTGTGTGT
ATAGTTAAAA GCTGCCTTTA TATTGTTATT ATAACTATTC TCTTTGGATG AAACAGTATC AAGGGTCGTC TAATTCTTTT
AAGCTTGGAG ACTATTGAAA GTCCTCGTGA GAGCGGTTCG TTTACTGCAG CTTCTAATTT GAATTCATCT CATGCTGGTT
CTCCATTCCC GGAATTTGTT GGATATGCAG CAGAGGAGCT GTCTAGTAAC AGCATGTGCA GCAGTCCTGA TGAAGTTTGC
TGCAATCAAA TTCAACCTGA ACTCATGGCA GGCCATTTGA GATCACTAGT CCAACATACA TTCAATGGCG CTGTTCTTGC
TGTACATCCA TATCTAGATA GATATGTGTT GGCAGCAGCT GGAAATGTGG TATGATTAGA AGTCAATTTT TATCATATAT
GATAGTATAT CTATTAAAGA GTAGCTTAGC TCGGTAATGG ATCTAGATAA ATAAATTTGC AAAGAAGCTT GAATGCTTGA
TTGGCAAGTT CCGGACTCTT GACATCAGAA TCAGTTAATC AACATTTATC CTGGCAAATA ACACTATTTA TGTGGATCGT
ATGGTGTTGG CTTCTTTCAC TTCTATAGAT TGCTAGAACA ACAGAACGAA GGTGCATTAG CACTTTAGCA TATGAGCCAC
ATTAATAGCA GAGGATTTTT TTTTGTAATA ACTACTGGAG AGATAGACTA GTGACGATTG GAGTTGAGGA GATGGAGATT
GGAAGGGTTA TTTGCCATTA TAAAAAAAAT CCTGAAAGAA TATCCCAACA AGAGTGTTAT TATTTTCCAA AACAAACAGT
TATCATGACG TCACTAAATT TTCTATCATT CTGTTACTAT CTGGTGCTAA TATGTTGATG CTGACAGATC CAGTTTGAAT
ACCACAATAT TTGAAAATCA TGATCTGAGA TTTTCTCTGC CTTATCTTGA CAGCTTTTTG TATTTGGATT TTTAAATGAA
AGTCCCCATC GGATAAAAAA GTATACTACG AGTAGGACAC GATTTACAAT AACCTGTTTG AAGACGTATG CATCACGGAT
TGCAGTGGGT GATTGCCGCG ATGGTGTTCT CTTCTATTCT TATCATGAGG TACAAGTTGA TTCAATTGAA ACAATACATT
TTTATGATGT TTATTTTTAT GGAGCTTCTT TGTCGTTACC TCTAATCCTC GTATTGATTT ATGCCAGAAT CTTAGGAAGT
TGGAACTGAT CTATTCTGAT CCTGCCCAAC GGCTAGTGGG TGATGTTGCC CTTTTGAGCT GTGAAACTGC TGTTGTATCA
GATCGACGAG GGAGCATATC TGTACTGTCT TGCCCAAGAT TAGAAGGTAT GCCTTGGTAT AGATGTCTAT GTTATCCCTT
TCTTTTTAGT TTGTACCTGT TCTTTTCTCT GGATTCTTTT TAATGGTAGT GCCTCCTCTA TACTCTTCTG CATCTTGGTC
ATACTTTGTA ATTTTGTAGC CTTCATGTTT AGTTTCTCAA TCTAATTCCT TTATTGACAT ACTAAATATG CAGTATAAAC
ATCACAATAT AGCTGGCATA AAATTTGCCA GTGTAGTAAG GCCACATAGT TGAATATTGT GCCTAGAAGC TTTATGAATT
TCGTAATAGA ATTCAAAATT TTGCATTACG TTTGTGTACT TCTCATCATA TATGCATTAC TTTGTAATAT CTACCTAAAT
TAATTTAAAT TTTACATTAC GTCAAGATTT ATTTTGACTT TTTTTAACAT ATCTTGCAGT ATCCGAAAGT CCAGAGAAGA
ACCTAGCGGT GCATTGTTCA TTTTACATGG GTGAAACAGC TATGAGCATC CAGAAGGTAA GCTTCTGTTG GCATCTTAGG
GCTAACCAGT GTGAATTCCA TTAACGAAAA CATACCAAAG AGAGGGTTTT GAACATGGGT ATTGGGTAGC TGCTTTGGAT
TTAAAGGATG AATCATGTGT TTGTAACTTG ATGAACTAAT GGGCTGTTTG GTTTGAGGAA TCAAATCATC CTAGGATGAG
TTTTTTCCAG CATGACCCAT CATGAgtagg ggtgaaacag tgcggaaacg gacggaaaca acctttatcg ttttcgtttt
catatttttt ttggaatcgg aaaccccgaa aacgaatatt ttcgaaactg aaaacagagc gaaaacgaac cggtgcggat
acggtaatga aaatttatcg gaatacaaaa acccctcaaa ctgagcttca aacttttgtc aagtctaatt ctcaagtctc
aacagtcaac aattcgtcat aaaacacaat tatatcaagt ctaattgtta agtctcaaca caagtacaca ataacacTTA
ACACGGAGTG ACGGAGGTGG AGGTTGAGGA ATAACACCTG CTGGCTGCTG CCACTGGGCT GCTGGCTGCT GCGAGGCGAG
GCGTTGTCGG CGGTGAGGAA GAGTCGCCAG TGGGGCTTGA GGTGTCGTAG ACTTGTCGGT GTGGCTATGG CGGCGTCGTC
AGTGGTGGTG GCGGCGGCGA AACGGCGAGA CGGCGGCGCG AAACGGCGGG ACGGCGCCGC GAGATGGTGG CGGTACGAGA
CGGCGGTATG GGACAACGAA GAGCGACTGC GAGAGAGGAA GGGTGGGCAC GGTCGCGAGG ACGGCAGGGG CGAGGTCACG
AGGAGCCGAG GACGGCAGAC CAGCGGTGGC GCGGGCGGTG GGCGCTGGGG AGCACGATGC CGTGATCTGG ATTCTGGATG
CGCTGCTCCG CCGCCGGCTC GCGGTCGCGC GATGCCGTGC TCCCGTGCAG CGATCAGTGT GTCTCTCCTC TCTAGGGTTA
GCCGCTATTT GGGTAGATGC TGCGATTTGG ATTGGGCTGG GAACTTGGGG ACGACTTATA GACTATTGAT TCTATGGGCC
TTTTTaactt cagaaattcc ggcaaatttt ttggaatttt tccgaccgat tccgagttcc gacggaaact gctattatca
tattcgattt cgtttccgag aaaatatttc cgttttcgat tccgtttctg agaaattctg aaaaaattct gaccagctga
ttccatttcc gaaaacaggc ccggaatccg gaaagtttcc gtaccgtttt cacccctaAT CTTGAGGTCA TCCCATGATT
TTGATGGGAT GATCCAATGA TCCCATTCAT CTTTTTTTTT CCAACTAAGC ATGTCGCTTT GAGGAATGAG GTAGAAATTT
AGTAGTCCAT TCTGCTCTTG TTTGGTTCGG AAGTTGGACC TGCTGGTGCA TTGAGTATCC AATTACTTAG ATGAAACAGC
CCATAATTGA TCTAGGAGAT TTGCCTTGTT ATCTCTCATG ATCCCGTTAT TTTCCCTGAA CATTTGGTTT TCATTCATCA
TGACCCGACC CTTTTCTTTC TATATGAGCC CCATGGAGAA GTGTGACCGA ACTAGTTTCA TGTTTTATAT TGTTGCTTTG
CTTTCCTATG GTTAATTCGG TCTTGTAATT TGCTGTAGGT TGCATTTAAG CATTGGCTTC CAATTGATGA TTTGACAGAA
CCAGTGTTGG AGTCGGTATA CAACTGTGTC GTCGCAAGCA CTCTGCTGGG GAGTATCTTT GTTATGATTC CACTCACAAG
GTGTAGTTTT GAAGATTCCA ACTCTAGAAT CTAAATTCAT GCTATTAGCT ATTTATCTGT GACAGCTCAG TCAGGGCCAC
TGCTAGCCTG TCGGTAACAT CTAAACCAAT TTGGGAGATT GAATTTGCTT TAAGTTAATC AGGGTTGTGA ACTATGATAG
TTTTGGCTAA GCTTCACAAT TATATTTGGT ACATGATTTT TGAAATGTTA TTCACATAAA TAATAAAATA GAACACTTTA
TCGTTTAGAA TTATTTGTTG CTATGCTGTT CCTGAGGACT AGATGCCATA CACATTGATA ATGTAAACAA AGTAGTCAAT
GCTCGCACCA TTACTAATTA AATCCAAATT GATTGTGTTT AACCTGATAA TTTGTTTGCG TACTAGTGTC GACAACTAAT
TGGTAAACTA AGCCCTTTCC CATTCTATAT CCTTTTGTAA CAAGGGGCCA GAGTTATTTT ATCTCTGCAC ACTAGTGTTA
TGATTCTGAA GCTAATGAAT TGGTAATGCA GTGAGGAGCA TCAAATGTTG CAAGATGTCC AAGAAAGACT TTCGGTTCAC
CCATTGACTG CTCCACTCTT AGGAAATGAT CATGCAGAGT TTCGTCGCCG TGGTATCCCG GTAAGATAAT TAAACTGCCA
TACTGAAAGC TAGTTTTTTT TGCAAGTGTT GAATAACCTT ATACACTACT GCTATGACAG TCGGGAGTAC CGCCCATTCT
GGATGGCGAC ATGCTTGTGC AGTTCCTGGA GCTCACCAGC GAACAACAGC ACGATGTTCT CAATATTGTT TCTCCTGGAA
AGAAGAGGCA ACACGATATC TCGGTTTTCC AGGTCATGCG AGCATTAGAG AGGGTGCATT ACGCACTCAA CTGAGGCGTT
CAACAATCCA TTCAACCCGG TCACTGTTCT TACCGACATG GCTGTCTCCA ACCTGCTGAT ATTTGGGTGG CATCATCGCT
GAATTTGGAT CCGAGCCGAG CACCGAGTTG TTGCAGCTGA AGCTGCTACT GGAGCACATA CCCAGAACAT ACCAAATCTC
AGCTGTAGTG AGGTGCTGTG TTTTGCTGTG GGATGATAGG CCCATCTGAT GTCGCAATAG TGTGTCATTG CTCTAGTGCA
ATCTTTGTAA ATAACGAATA ATATTTTGGC AGAAGGATGT GGATACAAAT CCTTTTGCCC AGTGAAAGGA ACAACCCTCG
TGAACGCATA A

Locus: Os07g0203700

Loading...

Locus: Os07g0203700

Loading...