Os07t0211500-01

Locus

Os07g0211500

Description

Basic helix-loop-helix (bHLH) protein, Proanthocyanidin synthesis, Regulation of proanthocyanidin pigmentation, (Nipponbare: loss-of-function mutation of Rc)

RAP-DB Gene Symbol Synonym(s)

Rc

RAP-DB Gene Name Synonym(s)

brown pericarp and seed coat

CGSNL Gene Symbol

RC

CGSNL Gene Name

BROWN PERICARP AND SEED COAT

Oryzabase Gene Symbol Synonym(s)

Rc, OsbHLH017, OsbHLH17, SD7-1, qSD7-1/qPC7, OsGL3C, GL3C

Oryzabase Gene Name Synonym(s)

Brown pericarp and seed coat, basic/helix-loop-helix 17, basic helix loop helix 17, GLABRA3C, GLABRA 3C

Transcript Evidence

DQ204736 (Jefferson)

Protein Evidence

Inferred from literature

Literature

PMID: 17163879

PMID: 16399804

Note

Manual Curation

June 22, 2018

Functional domain (InterPro)

Transcription factor MYC/MYB N-terminal (IPR025610)

Expression Databases

TENOR (Os07t0211500-00)

Others

Oryzabase (813)

KEGG (Os07t0211500-00)

Transcript

1987 bp

>Os07t0211500-01 Basic helix-loop-helix (bHLH) protein, Proanthocyanidin synthesis, Regulation of proanthocyanidin pigmentation, (Nipponbare: loss-of-function mutation of Rc)
ATGGCCGGCGGCGAGGCGCATGCGGCGCTGCAGGCGGTGGCGCAGAGCCTCCGGTGGACC
TACAGCCTCCTCTGGCAGCTCTGCCCCCACCAAGGGAGCTCGCTGGTGTGGGGGGAGGGG
CACTACAACGgcgccgtcaagacgcggaagtcgacggtgatgcagccgccgccggcggag
gaggaggacgacgccgaccacgcggcgcgccaccggagccggcagctgagggagctctac
gactggctgcagcaggccggggagaactccagcggcggcgtgcagacgtcgtcgacgacg
gcgagccggcggcCGGGGGCGGCTCTGTCGCCGGAGGACCTGACGGAGACGGAGTGGTTC
TTCCTCATGTCGGCATCCTACTCCTTCCCTCCCGGCATCGGGTTACCTGGAAGGGCATTT
GCAAGGAGAGGCCATGTATGGCTCACTGGAGCAAATGAAGTTGACAGCAAAGTATTCCTA
AGAGCAATTCTTGCCAAGACAGTTGTGTGCATTCCTGTTGTCGATGGCGTCCTGGAAATT
GGAACTACGGAAAAGGTGGAGGAAGATATGGGCCTGATTCAGTATGCAAGGGGCATCTTC
ATGGATCAACATGGCATCCACATGAAGCCTACCCTCTCACAGCACTCAACATCCAACCCA
GTCACCCACTGTACTCATCAGCATCCAATCCAGGTTCAGATGCAACTAGGTATCACCAGC
CAAACAAAGTTTGATTATTCAGATGAGCTCAATGCAGATGAGGAGAATGATGACACAGAA
GAAGAGGGCATGTCAGGTTCAGACACTAACAACACTGACACTGAAAGGAATTCAGGCCAG
CTGCAACTTCAAATGCAAGACCAACTGAACATGGTGAGCAATGACCACCAGACAATACCA
AATAATGCAGTTTCCAGTGAGCTAATGCAGTGTGAGATGTCAGAAGTGGTAAGAGATGGC
TGCTCAAATAATATTTTAGAGGATGAAATCCAAATGCTGATGGATTGCCAAAACAGTAAT
TGTCAGTTAAATTTGCAAGGGCCAGATGAGCCTTGTCACTCTTGGCATTTTCTCTGCGAG
GAGTTACAAAATGATTACCAGCCAGCTACTGAAGATCAAGTGGCATCACCTGAAAATACC
CATTACCCAAAAACACTCATGACAATCCTACATTACAACACGCTGCGACAGCAAGAGATG
AACATCAAGAACTACTTGCCAGTTTCAGAGAAATCATCATTCTCCAGATGGACTACTCCT
GAAGGAAGTGATGACAACAAGACCATGATCAGTCCAGGCACCACACAGAGAATGCTCAAG
AGCATCCTGATGATTGTTCCCAGTAGTCACTGCAGTTACAGGGGAGCAGAAACACCTGAA
TCAAGGGGCGGGAAAGGCGCAAGTGGATGCCATCCAAGGTGATTTCAGTGCCAACCATGT
GCTGAAAGAGAGGAGAAGAAGAGAGAAGCTCAATGAGAAGTTCATAATTCTGCGATCTTT
GGTACCTTTCATGACAAAGATGGACAAGGCGTCGATACTAGGCGACACGATCGAGTACGT
GAAGCAGCTAAGGAACCGCATACAAGAGCTCGAGTCGTCGTCGTCGTCGTCACGAGCAGC
CGCCCGGGCGCCATCGGCGGCGGCCGCCGGGAGGCGGAGGAAGAGATCCGCCGCCGCCGC
CACTGCCACGGCGGCGGAAGGGATGAGCAGCAGCAATGGCCGCAATGGCGGCGAGGCGGC
GGAGGTGGTGCAGGTGTCCATCATCGAGAGCGACGCGCTGCTGGAGCTCCGGTGCGGTTG
CGGCGGCGGCGGCGGCGGTGTGGTGCTGCTCCGGGTGATGCAGGCGATGCAGGAGCTCCA
GCTGGAGGTCACcgccgtccaggcctcgtgcgccggtggcgagctgctcgccgagctgcG
CGCCAAGGTCGTCGTTATGATCCTGATCTGCATGAAAATGCAAATGCAAATGCAAATGCA
GAATTAA

CDS

1422 bp

>Os07t0211500-01 Basic helix-loop-helix (bHLH) protein, Proanthocyanidin synthesis, Regulation of proanthocyanidin pigmentation, (Nipponbare: loss-of-function mutation of Rc)
ATGGCCGGCGGCGAGGCGCATGCGGCGCTGCAGGCGGTGGCGCAGAGCCTCCGGTGGACC
TACAGCCTCCTCTGGCAGCTCTGCCCCCACCAAGGGAGCTCGCTGGTGTGGGGGGAGGGG
CACTACAACGgcgccgtcaagacgcggaagtcgacggtgatgcagccgccgccggcggag
gaggaggacgacgccgaccacgcggcgcgccaccggagccggcagctgagggagctctac
gactggctgcagcaggccggggagaactccagcggcggcgtgcagacgtcgtcgacgacg
gcgagccggcggcCGGGGGCGGCTCTGTCGCCGGAGGACCTGACGGAGACGGAGTGGTTC
TTCCTCATGTCGGCATCCTACTCCTTCCCTCCCGGCATCGGGTTACCTGGAAGGGCATTT
GCAAGGAGAGGCCATGTATGGCTCACTGGAGCAAATGAAGTTGACAGCAAAGTATTCCTA
AGAGCAATTCTTGCCAAGACAGTTGTGTGCATTCCTGTTGTCGATGGCGTCCTGGAAATT
GGAACTACGGAAAAGGTGGAGGAAGATATGGGCCTGATTCAGTATGCAAGGGGCATCTTC
ATGGATCAACATGGCATCCACATGAAGCCTACCCTCTCACAGCACTCAACATCCAACCCA
GTCACCCACTGTACTCATCAGCATCCAATCCAGGTTCAGATGCAACTAGGTATCACCAGC
CAAACAAAGTTTGATTATTCAGATGAGCTCAATGCAGATGAGGAGAATGATGACACAGAA
GAAGAGGGCATGTCAGGTTCAGACACTAACAACACTGACACTGAAAGGAATTCAGGCCAG
CTGCAACTTCAAATGCAAGACCAACTGAACATGGTGAGCAATGACCACCAGACAATACCA
AATAATGCAGTTTCCAGTGAGCTAATGCAGTGTGAGATGTCAGAAGTGGTAAGAGATGGC
TGCTCAAATAATATTTTAGAGGATGAAATCCAAATGCTGATGGATTGCCAAAACAGTAAT
TGTCAGTTAAATTTGCAAGGGCCAGATGAGCCTTGTCACTCTTGGCATTTTCTCTGCGAG
GAGTTACAAAATGATTACCAGCCAGCTACTGAAGATCAAGTGGCATCACCTGAAAATACC
CATTACCCAAAAACACTCATGACAATCCTACATTACAACACGCTGCGACAGCAAGAGATG
AACATCAAGAACTACTTGCCAGTTTCAGAGAAATCATCATTCTCCAGATGGACTACTCCT
GAAGGAAGTGATGACAACAAGACCATGATCAGTCCAGGCACCACACAGAGAATGCTCAAG
AGCATCCTGATGATTGTTCCCAGTAGTCACTGCAGTTACAGGGGAGCAGAAACACCTGAA
TCAAGGGGCGGGAAAGGCGCAAGTGGATGCCATCCAAGGTGA

Protein

474 aa

>Os07t0211500-01 Basic helix-loop-helix (bHLH) protein, Proanthocyanidin synthesis, Regulation of proanthocyanidin pigmentation, (Nipponbare: loss-of-function mutation of Rc)
MAGGEAHAALQAVAQSLRWTYSLLWQLCPHQGSSLVWGEGHYNGAVKTRKSTVMQPPPAE
EEDDADHAARHRSRQLRELYDWLQQAGENSSGGVQTSSTTASRRPGAALSPEDLTETEWF
FLMSASYSFPPGIGLPGRAFARRGHVWLTGANEVDSKVFLRAILAKTVVCIPVVDGVLEI
GTTEKVEEDMGLIQYARGIFMDQHGIHMKPTLSQHSTSNPVTHCTHQHPIQVQMQLGITS
QTKFDYSDELNADEENDDTEEEGMSGSDTNNTDTERNSGQLQLQMQDQLNMVSNDHQTIP
NNAVSSELMQCEMSEVVRDGCSNNILEDEIQMLMDCQNSNCQLNLQGPDEPCHSWHFLCE
ELQNDYQPATEDQVASPENTHYPKTLMTILHYNTLRQQEMNIKNYLPVSEKSSFSRWTTP
EGSDDNKTMISPGTTQRMLKSILMIVPSSHCSYRGAETPESRGGKGASGCHPR*

CDS

chr07:6062889..6062983 (+ strand) : 95 bp

chr07:6063303..6063608 (+ strand) : 306 bp

chr07:6066306..6066402 (+ strand) : 97 bp

chr07:6066791..6066847 (+ strand) : 57 bp

chr07:6067050..6067599 (+ strand) : 550 bp

chr07:6067770..6068086 (+ strand) : 317 bp

3'UTR

chr07:6068087..6068183 (+ strand) : 97 bp

chr07:6068850..6069317 (+ strand) : 468 bp

FASTA

>Os07t0211500-01 class=Sequence position=chr07:6062889..6069317 (+ strand)
ATGGCCGGCG GCGAGGCGCA TGCGGCGCTG CAGGCGGTGG CGCAGAGCCT CCGGTGGACC TACAGCCTCC TCTGGCAGCT
CTGCCCCCAC CAAGGGTACC TACCCTACCT ACCTACGACA CGATGCACAG TGTTCATCCA TGGCCGGCCA TGGCGGATCG
TCGTCGTTGT CGATGATCAT CGAAGGAAGC TAGAGGATAT GGCTCAATAC TTTGATAATA TATATACTGA TCTCTCCGTA
CAACAAAAAT ATAAAAATTC TAGCTAGTAT CGAATGAGAC ATATGCTATG CTAGTACTAC GAATCTAAAA AGATGTACAT
ATTTTGATTC GTATTATTAG GATATATCAC GAGTTTTTAT ATTTTGAGAC GGATGTAATA ATTCTGAATT TAGTTGTGAT
CGCATGGCAT GCAGGAGCTC GCTGGTGTGG GGGGAGGGGC ACTACAACGg cgccgtcaag acgcggaagt cgacggtgat
gcagccgccg ccggcggagg aggaggacga cgccgaccac gcggcgcgcc accggagccg gcagctgagg gagctctacg
actggctgca gcaggccggg gagaactcca gcggcggcgt gcagacgtcg tcgacgacgg cgagccggcg gcCGGGGGCG
GCTCTGTCGC CGGAGGACCT GACGGAGACG GAGTGGTTCT TCCTCATGTC GGCATCCTAC TCCTTCCCTC CCGGCATCGG
GTATATAATA AAAAATATAG ATATAAATAT TTAAGCATGC ATGCATAAAT TAAACCACAC TTCTTGTTAC GTGTTCTTGG
CAAAATGATG AACAATTACC ACTAATTAAT TGGAGCCAGA AACCCTAAAG ATTTACCCAC CTGGTTAATT AATCGGTGTG
TTGATCCACG CATGCATGCA TGCAGAAAAT CAAGATCAGG ATAGCTCCTT TTCTTTTGCA GGTTAATTAG CTAGATCTTC
ACGTATAATT AGCTAGCTAG ATTTTAAAAT ATAATTTATT CAATTTGATT TATGATTTTT ATTTTTTATT TCAAATAGAT
ACAACTGTAT ACAAAATTTT ATTTTGGTAC ATACCTCCGA TCCAACTACA TCAGAGGTAA AAAAAAAATT AAACCGTTGG
AATTGATTAG AACAAGATCG TGCGGTCAAA TTATATCATA ACTAACTTTT CTGATTCTCT AAAGCATAGA GATGTATATA
TACATCGTAT TATTAGGCTC TATATTTCCT GATTAACACT AGATGCATAT ATAATTTTGA TAGTCAAAAT ATACTTTTGA
TAGGCTCTAA AGAAAAACTT AATAACATGT Actccctcca tatacttttg atagtcatat ttcatcttga cacacagatc
aagtataagt aattctactt atcatccatt taaacacgct actagttatt cctcataaac aagcgattca ttaatattta
catttctcga tgcttgtgta gccaatattg tgtggaagaa tggaatgtca ttaagaggat aggttgttgg attgaaatat
gcctatcaaa aataaatttt tagatttgaa aatatgccta tcaaaagtag atggagggag TATTAATTAA TGTGAATTTC
CAATCCTACT GTTGTGATAT TAGGCTTTGT ACCTTCTTGT CCAGGAGGTA TATATATGGC TCTTTTAAGG ATGGGAGAAA
ATATCATCTT TAATACAACT ATATATGGCT TTTGTTTGAT AAATACAACT TTTATTTTGT ATGAATACAA ATATATTGAT
AAATATCCAC CATTATAATC CTAACCCATT AGGATCATAT GGTGTATATT TTTTTAACTA TTTGTTTTTT ATAAATTAAT
ATTAAGAGAT CACAATAAAA ATATAGTATT ATGAAAGTAC TCTTAACAAC ATATCCAATG ATAAAATTAT TATTATTACA
AAATATAGTG GTCAAATTGT ATAGAATTCA ATAGCCTGAT TTTATGACGT CAAGTAAATT AAATAAAGAA TGAAGGTAGT
GCTAGAGTGA TCAAACAATA TCTCTCCTAA AATATGTCCT ATAAGTTTTA CTCCATAAAT CCAAGGGTCA AAAGTTGTTG
GGTTATTTTT TTAGATAATA ACATACTACC CCttttcaaa atgtatgatt ctattgactt tttgcacaac atttaaccat
ttgtcatatt aaaaattagt ataaacatct aaaaatataa gttacaatta tattttattt gatgataaaa caactcacaa
caaaataaat aatatttata taatcttttt ggaataaaac gaatgatcaa acattattca aaaagtcaat ggTATAGTAC
GTTTTGAAAT TGATAGACTA TGAGAGCAAA ATTTTGAGAT AACATGGAAA ATTATCCTCT TAGACATTGC ACTGTGTAAT
AATTAATAAT AATGAATGAA AGGCTAAGAC TTTTCTTCCA CCTTATATAA GTGGTTGAAT ATATAGCAAT CACATCATTA
CATGATTTTG TAACCAACCG TCTCTATAGC TCCGATACAG TGCTAGTTTC ACATCGTAAT AATTAAAGAG TATAATAATA
AATCGAGGTG TACTTCTCAT CGATGAAGTG ATGTGCCGCT TAGCTAAATT AAACTCGTAT GCGAAAAATC AGTATATGTC
CGGTTAATTT CTAAGAGAGA GATTGAGAGA GAATAATTGC GCCCCTCCAA ATCCCCCTCT TGGACGTTAG GGAGCTATAT
AGACGGTATT GCTAAGTGCG ATGTGTACAT AACGTACCTG TCGTAGGAAC ATTTCTCATC CAAATTAAGT AGTAATGCAT
GGCATGAAAT CCATTTTTGT ATTTTGCATG GCAAAGAATG ACAACAAGGA ATACACTAGC TAGCCCTGCC CTTTTTCAAT
TTAATTTAAC ATCAAACTTA GTTATTGTAT TTCTTTTGTC AGAATAGCAT GCATTGCATA CTCTTTAAAA ATAATTAATT
AGTGTATTTT ACTAGTCTTA CAAAAGTATC AAGAGAGACA ACTAATTATA GTTGGGAGAC ACCAAACTTG TTTTTAATAA
TGACAATTAA AACCCTACCT CTACATCCAA CATAGACGTA CATAGTCCGA AGGCGCCAAA TATTTGTACA TTTAGCTACC
AGATTTCAGT ACGAGTTCTC ACATTATAAT TTTGATTTTT TTATTTTTTT TATAAACAAT CTGGTACCCT TTTATGTCTG
GAAGGAAAAA AAAAATCTAA ATTGCAACAT TTTAGTCGGT GAGAATGGTA CTCTGTCCTA GCTACTTTCT ACACATGAGA
GAGAGAGAGA GAGAGAGAGA GAGAGCCTTT AATTGCCCTT GCCCATGCAT CTTTCTTTGC ACACATGTAT GCTTTTCACA
TTGTCATGAG GAGAGAACTT GTTAAGTTGC ACACATGTGT GCTTTGCATG TCTTCAGGTT ACCTGGAAGG GCATTTGCAA
GGAGAGGCCA TGTATGGCTC ACTGGAGCAA ATGAAGTTGA CAGCAAAGTA TTCCTAAGAG CAATTCTTGC CAAGGTTCAG
CCATCACCTT CTCTTACCTA TTTTTCACTC TGAATGCCAA CAGTGCTTTG CACATTGTAG TCTGTTTGCA GACTGCAAAT
GATGACCATA ATCAGATCAG AAAATAAAAT AATATTATAT ACTTTTTGAG CCAGCTAGCA AGAATATGTA ACAATAATTC
TCCTTTTTTT TTCTTGTTCT TTTCCCTGAT GTGGTGCATA ACAAATAACC AAACTGATGA ATGGCAGAGT GCTGGTATCC
AGGTATTTGC CTCTAAAAGT AGCTACACGT TTACTATGAA ATTTTGTGGC TTTTGTTCAT CTTTGGATGC AGTGGCCATT
ATCTAAAAAC TATGAATTTC CAGACTGCAG TTTTTATCTA ATTTTGTGAC TTTGTACATC AGACAGTTGT GTGCATTCCT
GTTGTCGATG GCGTCCTGGA AATTGGAACT ACGGAAAAGG TGATTTCGTA TATTATCAGC TGACAATCTA ATTATATGGG
CCATATAATT AAGTATAAAT CAAAATACCT CATAATATAT TATAAAGTAT CTAATGTGAT TATGTGAATA TTGGCTATTT
CAATGTAATT TGATATATGA AACTGATAAT CCTCTGAAAC TCCGTAAGGA TCAAACTAAT CAAAATGTAT ATATTTTCAA
GGTGGAGGAA GATATGGGCC TGATTCAGTA TGCAAGGGGC ATCTTCATGG ATCAACATGG CATCCACATG AAGCCTACCC
TCTCACAGCA CTCAACATCC AACCCAGTCA CCCACTGTAC TCATCAGCAT CCAATCCAGG TTCAGATGCA ACTAGGTATC
ACCAGCCAAA CAAAGTTTGA TTATTCAGAT GAGCTCAATG CAGATGAGGA GAATGATGAC ACAGAAGAAG AGGGCATGTC
AGGTTCAGAC ACTAACAACA CTGACACTGA AAGGAATTCA GGCCAGCTGC AACTTCAAAT GCAAGACCAA CTGAACATGG
TGAGCAATGA CCACCAGACA ATACCAAATA ATGCAGTTTC CAGTGAGCTA ATGCAGTGTG AGATGTCAGA AGTGGTAAGA
GATGGCTGCT CAAATAATAT TTTAGAGGAT GAAATCCAAA TGCTGATGGA TTGCCAAAAC AGTAATTGTC AGTTAAATTT
GCAAGGGCCA GATGAGCCTT GTCACTCTTG GCATTTTCTC TGCGAGGAGT TACAAAATGA TTACCAGCCA GGTATTACAT
TTGAGAAGAT AATCCTTCAA AAGCACCCTT GTTCCAAAAA TATATATTTG TACTCTTCAC ACAAGCACTG CCATTTTTTT
TCTTTTTTGC ATACATCCTC AATTCTTGCA TTTCTTTTCC ATATATTTGA TACAACTGTC TCCATTTCCC TTCTGTCACA
GCTACTGAAG ATCAAGTGGC ATCACCTGAA AATACCCATT ACCCAAAAAC ACTCATGACA ATCCTACATT ACAACACGCT
GCGACAGCAA GAGATGAACA TCAAGAACTA CTTGCCAGTT TCAGAGAAAT CATCATTCTC CAGATGGACT ACTCCTGAAG
GAAGTGATGA CAACAAGACC ATGATCAGTC CAGGCACCAC ACAGAGAATG CTCAAGAGCA TCCTGATGAT TGTTCCCAGT
AGTCACTGCA GTTACAGGGG AGCAGAAACA CCTGAATCAA GGGGCGGGAA AGGCGCAAGT GGATGCCATC CAAGGTGATT
TCAGTGCCAA CCATGTGCTG AAAGAGAGGA GAAGAAGAGA GAAGCTCAAT GAGAAGTTCA TAATTCTGCG ATCTTTGGTA
CCTTTCATGA CAAAGGTAAT TAAGTACTCC CTCTATTTCT ATAAAGCCGt atttgactag ttatcttatt tagaaagtat
gtgcaaatat gtaaaatata agtcatactt aaagaacttt taatgttatt aaataataag tcacaccaaa aataaaacat
atatattttt aataagataa atgattaaat gtatatataa aaattaatag cgtcacatat tttaaaataG AGGGGTATTT
AAGTACCCAC AGGATCATCA AAATTCAGTT ATCTTTTCTT AAGCCTCTAA CGAACATTGG AAGATCCTCA CTAATGGCAG
CATGAATCTA GGGTTCACTA TTTCGGAATG Caaaatatgt tttaccgggc atccgatttt taaaaaattc agaatgaaga
aaattgaatc ttttttatgg atttgaataa atcttgataa atTCGAAAAA ATTTCCGAAC TTTTGGCCAG AAGTGAATCC
TACCCGTATC CACCGGTAAT AAACCTAAAT TTTTGGGAGT AATGAATTAA TGTTATATAT AATCCATGAA TTATATAGTT
CCAAACTACT CCGTAACAAA TTTTCAGGAG TAGTGAAATT AATATTATTA CAATCTCAGA AAAAAATGGC AGAAACAATT
AATCTGTTTT CAATTATTAA TTAATTTGTT TTTGTGTCCA GATGGACAAG GCGTCGATAC TAGGCGACAC GATCGAGTAC
GTGAAGCAGC TAAGGAACCG CATACAAGAG CTCGAGTCGT CGTCGTCGTC GTCACGAGCA GCCGCCCGGG CGCCATCGGC
GGCGGCCGCC GGGAGGCGGA GGAAGAGATC CGCCGCCGCC GCCACTGCCA CGGCGGCGGA AGGGATGAGC AGCAGCAATG
GCCGCAATGG CGGCGAGGCG GCGGAGGTGG TGCAGGTGTC CATCATCGAG AGCGACGCGC TGCTGGAGCT CCGGTGCGGT
TGCGGCGGCG GCGGCGGCGG TGTGGTGCTG CTCCGGGTGA TGCAGGCGAT GCAGGAGCTC CAGCTGGAGG TCACcgccgt
ccaggcctcg tgcgccggtg gcgagctgct cgccgagctg cGCGCCAAGG TCGTCGTTAT GATCCTGATC TGCATGAAAA
TGCAAATGCA AATGCAAATG CAGAATTAA