Os07t0218900-00

Locus

Os07g0218900

Description

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

Protein Evidence

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Expression Databases

TENOR (Os07t0218900-00)

Transcript

510 bp

>Os07t0218900-00
ATGGCAAAGCTCATCAGGTCGCTGAGAGTGATGGCGAAGGTACAAGCTAAGCTACGTCAA
GCCTTTCAAGGAAAGAGCACTATCACTGAAGACGATATTGGAAAATTGAGCTATTTCAAG
ATGGTGATAAAGGAGTCCTTGAGACTACATTGCCCGGCGCCCTTCTTGATCCCTCGAAAA
TGCCATGAGACAAGCAAGATCATGGGTTATGATGTACCTAAGGGTACATCAATATTTGTG
AATATGTGGGCAATTTGCAGGGATAGTAAGTATTGGGAGAATGCCAAAGAATTCATGCCA
GAGAGACGCAGGATATGTCCCGGCATAAATCTTGGGCTGGCCAACATAGAGCTTGCCTTG
GCTAACCTTCTTTATCATTTCGATTGGAAGTTGCCAAATGGAATGTTGCACAAGGATCTT
GATATGCGGGAGGCACTTGAACTTCTTGCTGCTAAACACACTAGTCTGAATGTGTGTCCA
GTTAGTAAGATTGCTTCAAGGTGTGCATAA

CDS

510 bp

>Os07t0218900-00
ATGGCAAAGCTCATCAGGTCGCTGAGAGTGATGGCGAAGGTACAAGCTAAGCTACGTCAA
GCCTTTCAAGGAAAGAGCACTATCACTGAAGACGATATTGGAAAATTGAGCTATTTCAAG
ATGGTGATAAAGGAGTCCTTGAGACTACATTGCCCGGCGCCCTTCTTGATCCCTCGAAAA
TGCCATGAGACAAGCAAGATCATGGGTTATGATGTACCTAAGGGTACATCAATATTTGTG
AATATGTGGGCAATTTGCAGGGATAGTAAGTATTGGGAGAATGCCAAAGAATTCATGCCA
GAGAGACGCAGGATATGTCCCGGCATAAATCTTGGGCTGGCCAACATAGAGCTTGCCTTG
GCTAACCTTCTTTATCATTTCGATTGGAAGTTGCCAAATGGAATGTTGCACAAGGATCTT
GATATGCGGGAGGCACTTGAACTTCTTGCTGCTAAACACACTAGTCTGAATGTGTGTCCA
GTTAGTAAGATTGCTTCAAGGTGTGCATAA

Protein

170 aa

>Os07t0218900-00
MAKLIRSLRVMAKVQAKLRQAFQGKSTITEDDIGKLSYFKMVIKESLRLHCPAPFLIPRK
CHETSKIMGYDVPKGTSIFVNMWAICRDSKYWENAKEFMPERRRICPGINLGLANIELAL
ANLLYHFDWKLPNGMLHKDLDMREALELLAAKHTSLNVCPVSKIASRCA*

CDS

chr07:6602159..6602463 (+ strand) : 305 bp

chr07:6602527..6602731 (+ strand) : 205 bp

FASTA

>Os07t0218900-00 class=Sequence position=chr07:6602159..6602731 (+ strand)
ATGGCAAAGC TCATCAGGTC GCTGAGAGTG ATGGCGAAGG TACAAGCTAA GCTACGTCAA GCCTTTCAAG GAAAGAGCAC
TATCACTGAA GACGATATTG GAAAATTGAG CTATTTCAAG ATGGTGATAA AGGAGTCCTT GAGACTACAT TGCCCGGCGC
CCTTCTTGAT CCCTCGAAAA TGCCATGAGA CAAGCAAGAT CATGGGTTAT GATGTACCTA AGGGTACATC AATATTTGTG
AATATGTGGG CAATTTGCAG GGATAGTAAG TATTGGGAGA ATGCCAAAGA ATTCATGCCA GAGAGGTTCG AAACCAACAA
TATATAATTC AAAGGGAATA ACTTTGAGTT TCTTCCATTT GGCTCTAGAC GCAGGATATG TCCCGGCATA AATCTTGGGC
TGGCCAACAT AGAGCTTGCC TTGGCTAACC TTCTTTATCA TTTCGATTGG AAGTTGCCAA ATGGAATGTT GCACAAGGAT
CTTGATATGC GGGAGGCACT TGAACTTCTT GCTGCTAAAC ACACTAGTCT GAATGTGTGT CCAGTTAGTA AGATTGCTTC
AAGGTGTGCA TAA

Locus: Os07g0218900

Loading...

Locus: Os07g0218900

Loading...