Os07t0222300-01

Locus

Os07g0222300

Description

Eukaryotic translation initiation factor 3 subunit E, Organ growth and pollen development

RAP-DB Gene Symbol Synonym(s)

EIF3E, eIF-3e, OseIF3e

RAP-DB Gene Name Synonym(s)

EUKARYOTIC INITIATION FACTOR 3E, eukaryotic translation initiation factor 3 subunit E

CGSNL Gene Symbol

EIF3E

CGSNL Gene Name

EUKARYOTIC INITIATION FACTOR 3E

Oryzabase Gene Symbol Synonym(s)

eIF-3e, OseIF3e

Oryzabase Gene Name Synonym(s)

Eukaryotic translation initiation factor 3 subunit e

Transcript Evidence

AK065461

Protein Evidence

Q8GVI0

Literature

PMID: 27703462

PMID: 23147221

Note

Manual Curation

October 7, 2016

Gene Ontology (GO)

Molecular Function: translation initiation factor activity (GO:0003743)

Molecular Function: protein binding (GO:0005515)

Cellular Component: cytoplasm (GO:0005737)

Cellular Component: eukaryotic translation initiation factor 3 complex (GO:0005852)

Functional domain (InterPro)

Eukaryotic translation initiation factor 3 subunit E (IPR016650)

Eukaryotic translation initiation factor 3 subunit E, N-terminal (IPR019010)

Tetratricopeptide-like helical domain (IPR011990)

Proteasome component (PCI) domain (IPR000717)

Winged helix-turn-helix DNA-binding domain (IPR011991)

Full-length cDNA

J013021F09 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0222300-01)

RiceXPro (AK065461)

Others

Oryzabase (14360)

KEGG (Os07t0222300-01)

Transcript

1761 bp

>Os07t0222300-01 Eukaryotic translation initiation factor 3 subunit E, Organ growth and pollen development
CTCCTCCCGCCGCCGCCGCACGCGGAACCCTAGAAAACCCTAGCAGCGGCGAGCACCGGG
GAGCGGGCGGCCATGGCGGAGCACGACCTGACGGCGCGGATGGCGGGGCAGATGGACTGC
CACCTGGTGTTCCCGCTGCTGGAGTTCCTGCAGGAGCGTGCGCTGTACGCGAACAAGGAG
ATCCTGGAGGCGAAGCTCCGCCTCCTCAGCGGGACCAACATGGTGGACTACGCCATGGAC
ATCCACAAGTCCCTCCACGACACCGACGAGGTCCCCGACGACATGGTCAGGCGCCGCACC
GACGTCGTCTCCAGGCTCAGGGCGCTCGACGAGGCCACCGCCCCCATCGTCTCCTTCCTC
CAGAACCAGCAGCTCGTCCAGGAGCTCAGGCCAGACAAGCAGTACAACCTCCACATGCTC
CAGGACCGCTTCCAGATTGGTCCTGAGCAGATTGAGACTCTGTATCAGTTTGCCAAGTTT
CAGTTTGACTGCGGTAATTACTCAGATGCTGCTGTCTACTTGTATCAATACCGTGCTTTG
TGCACGAACAGCGAGAGGAGCTTGAGTGCCCTGTGGGGAAAGCTGGCAGCCGAGATTTTG
ATGCAGAACTGGGATGTTGCACTGGATGAGCTCAACCGTTTGAAGGAGATTATTGATTCA
AAGAACTTCTCATCACCACTAAATCAGCTCCAGAATAGGATATGGCTGATGCATTGGAGT
ATTTTTATCTTCTTTAACCATGAAAACGGCAGAAATGGGATCATCGATCTGTTCTTCCAG
GATAGGTACTTGAACGCAATCCAGACAAATGCACCCCATCTTCTGAGATACCTTGCTACA
GCAGTTGTCGTGAACAAAAGGAGAAGGAACATGCTTAAAGAGTTGATTAAAGTCATTCAG
CAGGAGCAGCACAGCTACAAGGATCCCATCACTGAATTCTTGGAATGCTTGTATGTTAAC
TATGATTTTGATGGTGCACAACAGAAACTCATAGAGTGTGAGCAGGTCATATTGAATGAT
CCTTTCCTTGGAAAGCGCATTGAGGAAGGGAATTTTGTCACTGTTCCTTTGAGAGATGAA
TTCCTTGAAAATGCTCGTCTGTTTATCTTTGAAACTTACTGCCGTATTCATCGGTGCATT
GATATTGGCATGCTTTCTCAGAAGCTGAACATGAGCTACGATGAGGCAGAATTGTGGATT
ATGAACTTAGTTAGGAATTCAAAGCTCGACGCCAAGATTGATTCAGTGTCTGGAACTCTT
ATCATGACGACCAATCATGTTAACATCCATGAGCAGGTTATCGAAAGCTTAAAGAATCTT
AACATGCGGACTTTCCTGCTAGCAAAGAACATTGTGGAGCCGGCTCAAGCAGCACAACAG
GCAGCTCGGTGAGATTGACAGAGAAGACCACAGTTTTGAGGCGCCCGGAATTATTTAAGT
AGAGACAATCCTCTAAACTTTTGGAGTTTTGTTGTTTAGCATTGACTCCGTTATCAGTAC
CTAAGATCATCTAGGAGGTGGTTTCTCGTTCGCTACAGCATATGCCGACGTTTTCTTTCT
ATTTTGTACTTGGAATCCTGTGGCTGAAGTTAATCCTTTCGTTGGTACTACAATCAAGTA
TTACCTGATTGTTATGGTGTTTCGTGTTGAAGTGAAGTGCGGAAGTGTGGTCATTTTTAT
AATTGTAGGTTCAATGTTTTTCTTGGTTCTGCTAAATTTGTGGCGCCACATTTTACCTTG
ATTTCAGTCAATTATTTGACC

CDS

1320 bp

>Os07t0222300-01 Eukaryotic translation initiation factor 3 subunit E, Organ growth and pollen development
ATGGCGGAGCACGACCTGACGGCGCGGATGGCGGGGCAGATGGACTGCCACCTGGTGTTC
CCGCTGCTGGAGTTCCTGCAGGAGCGTGCGCTGTACGCGAACAAGGAGATCCTGGAGGCG
AAGCTCCGCCTCCTCAGCGGGACCAACATGGTGGACTACGCCATGGACATCCACAAGTCC
CTCCACGACACCGACGAGGTCCCCGACGACATGGTCAGGCGCCGCACCGACGTCGTCTCC
AGGCTCAGGGCGCTCGACGAGGCCACCGCCCCCATCGTCTCCTTCCTCCAGAACCAGCAG
CTCGTCCAGGAGCTCAGGCCAGACAAGCAGTACAACCTCCACATGCTCCAGGACCGCTTC
CAGATTGGTCCTGAGCAGATTGAGACTCTGTATCAGTTTGCCAAGTTTCAGTTTGACTGC
GGTAATTACTCAGATGCTGCTGTCTACTTGTATCAATACCGTGCTTTGTGCACGAACAGC
GAGAGGAGCTTGAGTGCCCTGTGGGGAAAGCTGGCAGCCGAGATTTTGATGCAGAACTGG
GATGTTGCACTGGATGAGCTCAACCGTTTGAAGGAGATTATTGATTCAAAGAACTTCTCA
TCACCACTAAATCAGCTCCAGAATAGGATATGGCTGATGCATTGGAGTATTTTTATCTTC
TTTAACCATGAAAACGGCAGAAATGGGATCATCGATCTGTTCTTCCAGGATAGGTACTTG
AACGCAATCCAGACAAATGCACCCCATCTTCTGAGATACCTTGCTACAGCAGTTGTCGTG
AACAAAAGGAGAAGGAACATGCTTAAAGAGTTGATTAAAGTCATTCAGCAGGAGCAGCAC
AGCTACAAGGATCCCATCACTGAATTCTTGGAATGCTTGTATGTTAACTATGATTTTGAT
GGTGCACAACAGAAACTCATAGAGTGTGAGCAGGTCATATTGAATGATCCTTTCCTTGGA
AAGCGCATTGAGGAAGGGAATTTTGTCACTGTTCCTTTGAGAGATGAATTCCTTGAAAAT
GCTCGTCTGTTTATCTTTGAAACTTACTGCCGTATTCATCGGTGCATTGATATTGGCATG
CTTTCTCAGAAGCTGAACATGAGCTACGATGAGGCAGAATTGTGGATTATGAACTTAGTT
AGGAATTCAAAGCTCGACGCCAAGATTGATTCAGTGTCTGGAACTCTTATCATGACGACC
AATCATGTTAACATCCATGAGCAGGTTATCGAAAGCTTAAAGAATCTTAACATGCGGACT
TTCCTGCTAGCAAAGAACATTGTGGAGCCGGCTCAAGCAGCACAACAGGCAGCTCGGTGA

Protein

440 aa

>Os07t0222300-01 Eukaryotic translation initiation factor 3 subunit E, Organ growth and pollen development
MAEHDLTARMAGQMDCHLVFPLLEFLQERALYANKEILEAKLRLLSGTNMVDYAMDIHKS
LHDTDEVPDDMVRRRTDVVSRLRALDEATAPIVSFLQNQQLVQELRPDKQYNLHMLQDRF
QIGPEQIETLYQFAKFQFDCGNYSDAAVYLYQYRALCTNSERSLSALWGKLAAEILMQNW
DVALDELNRLKEIIDSKNFSSPLNQLQNRIWLMHWSIFIFFNHENGRNGIIDLFFQDRYL
NAIQTNAPHLLRYLATAVVVNKRRRNMLKELIKVIQQEQHSYKDPITEFLECLYVNYDFD
GAQQKLIECEQVILNDPFLGKRIEEGNFVTVPLRDEFLENARLFIFETYCRIHRCIDIGM
LSQKLNMSYDEAELWIMNLVRNSKLDAKIDSVSGTLIMTTNHVNIHEQVIESLKNLNMRT
FLLAKNIVEPAQAAQQAAR*

5'UTR

chr07:6767200..6767271 (- strand) : 72 bp

CDS

chr07:6766837..6767199 (- strand) : 363 bp

chr07:6766161..6766388 (- strand) : 228 bp

chr07:6765931..6766052 (- strand) : 122 bp

chr07:6765232..6765451 (- strand) : 220 bp

chr07:6764634..6764776 (- strand) : 143 bp

chr07:6764108..6764245 (- strand) : 138 bp

chr07:6763867..6763972 (- strand) : 106 bp

3'UTR

chr07:6763498..6763866 (- strand) : 369 bp

FASTA

>Os07t0222300-01 class=Sequence position=chr07:6763498..6767271 (- strand)
CTCCTCCCGC CGCCGCCGCA CGCGGAACCC TAGAAAACCC TAGCAGCGGC GAGCACCGGG GAGCGGGCGG CCATGGCGGA
GCACGACCTG ACGGCGCGGA TGGCGGGGCA GATGGACTGC CACCTGGTGT TCCCGCTGCT GGAGTTCCTG CAGGAGCGTG
CGCTGTACGC GAACAAGGAG ATCCTGGAGG CGAAGCTCCG CCTCCTCAGC GGGACCAACA TGGTGGACTA CGCCATGGAC
ATCCACAAGT CCCTCCACGA CACCGACGAG GTCCCCGACG ACATGGTCAG GCGCCGCACC GACGTCGTCT CCAGGCTCAG
GGCGCTCGAC GAGGCCACCG CCCCCATCGT CTCCTTCCTC CAGAACCAGC AGCTCGTCCA GGAGCTCAGG CCAGACAAGC
AGTACAACCT CCACATGCTC CAGGACCGCT TCCAGGTCGA TCTACTTCTC CCCCCACCTT TGCCCCGCTC GTTAGATCTG
TTCTTCGTCG CCGCTAGCCT CTGTGTTATG TTAGGTTTGT TTTCTCTGTG CAGAAATGTT TTTGTGATTT GCAGGTGGCG
ATGCGATGTT GTGAGATTGG TTTAGTTTTA TTCACTTGTT GGTTTGGGTA AAATTGGCAC AGTTGGTGAT TCTTAGCTTG
AGATTGTGCT TGATCTTAAT ATGGTTAGAA TAATTTTAAA TCGCCGTCAA GTATAGGAGG GTTTGCTTGT AATTGTAGGT
ATTGGGCTTG TTTATGGAAG CATCAACTCT GTATGTTCCT CATTGCTTCA GTTGTTGAAT TTTGTTGTTA CCATGATTTT
GTTAAGTCGG TTAGCATGCT GTATACTTAT TGCATGTTTT TGTGCGACCC AACTAAATAA TCAAACTCCT GTTAATGATG
CAGATTGGTC CTGAGCAGAT TGAGACTCTG TATCAGTTTG CCAAGTTTCA GTTTGACTGC GGTAATTACT CAGATGCTGC
TGTCTACTTG TATCAATACC GTGCTTTGTG CACGAACAGC GAGAGGAGCT TGAGTGCCCT GTGGGGAAAG CTGGCAGCCG
AGATTTTGAT GCAGAACTGG GATGTTGCAC TGGATGAGCT CAACCGTTTG AAGGAGATTA TTGATTCAAA GGTTTGGCTG
AATGACTATA TCACTTGTTG TGGTTGGTTA GGTGCTTTAC CTAACTATTT TTTTAGGGGA ATCACATAAC TAATTTTGTT
CCTTTTTTTA TTCTCCCAGA ACTTCTCATC ACCACTAAAT CAGCTCCAGA ATAGGATATG GCTGATGCAT TGGAGTATTT
TTATCTTCTT TAACCATGAA AACGGCAGAA ATGGGATCAT CGATCTGTTC TTCCAGGATA GGTTTGTTTA CTAAAATCTC
AACATTATTG TGACCACTTG TCTTGTGCTG TTACAAATTT TTGAAGTAAG TTTTTCTGGC CAAGCCGAAT TGGAAGAAAA
TAAAAAGAAC AGAGTTAAAA AGTTGATTAC AGAGCCAAGG GGCTTCTGTT GTCCATACAA CACTTGCTTt actacctccg
tctcaaaatg tagctaccta gtacgagacg tgacactacc taggactacg aatctggata gcctcttgtc cagattcgta
gaactagatg tggcactacc tagtactacg aatctggaca gcctcttgtc cagattcgta gaactaggtg gtgtcacatc
ccatactaaa tagctacatt ttgggacgga ggaagtaTTA TTTTTACTGT GCTATCTAGT TGCAATGATG GAACTATATT
TTATTCTGTA TATCAAGATT ATCTCAGCTA ATTTTCAATT TGCACCTTTC GTCTAACCAG GTACTTGAAC GCAATCCAGA
CAAATGCACC CCATCTTCTG AGATACCTTG CTACAGCAGT TGTCGTGAAC AAAAGGAGAA GGAACATGCT TAAAGAGTTG
ATTAAAGTCA TTCAGCAGGA GCAGCACAGC TACAAGGATC CCATCACTGA ATTCTTGGAA TGCTTGTATG TTAACTATGA
TTTTGATGGT GCACAACAGA AACTCATAGA GTGTGAGCAG GTATGTTAGC ATGTTTTGAA CCTTTTGTCC ATCCCATCAC
TATTTTTTTT AACTTGGTGC ATTACTAAAT ATGATATGAA AACATTGAAA GACAATTTCT CCTCACTTTT TTTTTTGGCA
AAACATCCTT TTCCTATATG AATTTTCACT TGCTAGTTCT GTCCTCCGAC TAAAATATTT TATGTTTGGC AAGGCAAAGT
TCACCTCTGA CATCCTTATA TCTCTGAGGC CTATGTGGGG GGTTCCTGGC ATGTATATAT TTCTGGAGTT GAACATTAGC
TTATTGTTGT TACTTTATTT TATGTTTTTC CTCAAATGAT AACTGTTTCT CTGGGCATAG CTATGATTTT GCATTACCAA
ATTTTGGGCT ATTTCTGTAT TATTGTCTTC TCAATGGTGA TCATACTGTT ACATAACAAT CTTGCATTTA TCTGTTCTAA
TGGCTACCTT TGTAGGTCAT ATTGAATGAT CCTTTCCTTG GAAAGCGCAT TGAGGAAGGG AATTTTGTCA CTGTTCCTTT
GAGAGATGAA TTCCTTGAAA ATGCTCGTCT GTTTATCTTT GAAACTTACT GCCGTATTCA TCGGTGCATT GATATTGGGT
AGGTGTTTCT GTCAATATAC TAATTTTTTT TTTGCTGACA TGAAAAAAAG TTCACTAAGA CGAATGGTAG AAATTGTAGT
TATACATTAT CATTTCAATA ATCATGTGTC GGATATAAGT TGGTTCTGTA CCTTGCTTGG GCTTGCATTG TTTTCCAATC
AACTGCTTTC CATGTTATAG GGAATACTCA ATGTTTATCA GCAAAAAACT GTATCATTAC TTTATTTTAG TTGCCGTTGC
ATCTCTGTTC TGTCTTCTCA GTTAGAAATA GTTTTACTAA ATTTGCACAC GTTTTATATA GGTTTATTCT TCATATTATA
TGGACCATGC AGGAATACAG TTTCTTTCAT ATCTAAGATG TTCTTCCAAT GTTTTGCAAT GAACAGCATG CTTTCTCAGA
AGCTGAACAT GAGCTACGAT GAGGCAGAAT TGTGGATTAT GAACTTAGTT AGGAATTCAA AGCTCGACGC CAAGATTGAT
TCAGTGTCTG GAACTCTTAT CATGACGACC AATCATGTTA ACATGTAAGT TGCTCAGGCC ATACATGCTG CGAGTATATG
CCAGTTCATG CTATGTGCTT TTTAACTCAT TAAAGCTATG GTTGACCTAA GCTTTCGACA ATGCGATTGA ATCTAATTAA
TCATTTATTC ATGTTGCAGC CATGAGCAGG TTATCGAAAG CTTAAAGAAT CTTAACATGC GGACTTTCCT GCTAGCAAAG
AACATTGTGG AGCCGGCTCA AGCAGCACAA CAGGCAGCTC GGTGAGATTG ACAGAGAAGA CCACAGTTTT GAGGCGCCCG
GAATTATTTA AGTAGAGACA ATCCTCTAAA CTTTTGGAGT TTTGTTGTTT AGCATTGACT CCGTTATCAG TACCTAAGAT
CATCTAGGAG GTGGTTTCTC GTTCGCTACA GCATATGCCG ACGTTTTCTT TCTATTTTGT ACTTGGAATC CTGTGGCTGA
AGTTAATCCT TTCGTTGGTA CTACAATCAA GTATTACCTG ATTGTTATGG TGTTTCGTGT TGAAGTGAAG TGCGGAAGTG
TGGTCATTTT TATAATTGTA GGTTCAATGT TTTTCTTGGT TCTGCTAAAT TTGTGGCGCC ACATTTTACC TTGATTTCAG
TCAATTATTT GACC

Locus: Os07g0222300

Loading...

Locus: Os07g0222300

Loading...