Os07t0222300-02

Locus

Os07g0222300

Description

Similar to Eukaryotic initiation factor 3e.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

EIF3E

CGSNL Gene Name

EUKARYOTIC INITIATION FACTOR 3E

Oryzabase Gene Symbol Synonym(s)

eIF-3e, OseIF3e

Oryzabase Gene Name Synonym(s)

Eukaryotic translation initiation factor 3 subunit e

Transcript Evidence

AK062040 (DDBJ, Best hit)

Protein Evidence

A0MLU6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Proteasome component (PCI) domain (IPR000717)

Winged helix-turn-helix transcription repressor DNA-binding (IPR011991)

Full-length cDNA

001-044-A02 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0222300-02)

RiceXPro (AK062040)

Others

Oryzabase (14360)

KEGG (Os07t0222300-02)

Transcript

744 bp

>Os07t0222300-02 Similar to Eukaryotic initiation factor 3e.
AAGTCATTCAGCAGGAGCAGCACAGCTACAAGGATCCCATCACTGAATTCTTGGAATGCT
TGTATGTTAACTATGATTTTGATGGTGCACAACAGAAACTCATAGAGTGTGAGCAGGTCA
TATTGAATGATCCTTTCCTTGGAAAGCGCATTGAGGAAGGGAATTTTGTCACTGTTCCTT
TGAGAGATGAATTCCTTGAAAATGCTCGTCTGTTTATCTTTGAAACTTACTGCCGTATTC
ATCGGTGCATTGATATTGGCATGCTTTCTCAGAAGCTGAACATGAGCTACGATGAGGCAG
AATTGTGGATTATGAACTTAGTTAGGAATTCAAAGCTCGACGCCAAGATTGATTCAGTGT
CTGGAACTCTTATCATGACGACCAATCATGTTAACATCCATGAGCAGGTTATCGAAAGCT
TAAAGAATCTTAACATGCGGACTTTCCTGCTAGCAAAGAACATTGTGGAGCCGGCTCAAG
CAGCACAACAGGCAGCTCGGTGAGATTGACAGAGAAGACCACAGTTTTGAGGCGCCCGGA
ATTATTTAAGTAGAGACAATCCTCTAAACTTTTGGAGTTTTGTTGTTTAGCATTGACTCC
GTTATCAGTACCTAAGATCATCTAGGAGGTGGTTTCTCGTTCGCTACAGCATATGCCGAC
GTTTTCTTTCTATTTTGTACTTGGAATCCTGTGGCTGAAGTTAATCCTTTCGTTGGTACT
ACAATCAAGTATTACCTGATTGTT

CDS

501 bp

>Os07t0222300-02 Similar to Eukaryotic initiation factor 3e.
GTCATTCAGCAGGAGCAGCACAGCTACAAGGATCCCATCACTGAATTCTTGGAATGCTTG
TATGTTAACTATGATTTTGATGGTGCACAACAGAAACTCATAGAGTGTGAGCAGGTCATA
TTGAATGATCCTTTCCTTGGAAAGCGCATTGAGGAAGGGAATTTTGTCACTGTTCCTTTG
AGAGATGAATTCCTTGAAAATGCTCGTCTGTTTATCTTTGAAACTTACTGCCGTATTCAT
CGGTGCATTGATATTGGCATGCTTTCTCAGAAGCTGAACATGAGCTACGATGAGGCAGAA
TTGTGGATTATGAACTTAGTTAGGAATTCAAAGCTCGACGCCAAGATTGATTCAGTGTCT
GGAACTCTTATCATGACGACCAATCATGTTAACATCCATGAGCAGGTTATCGAAAGCTTA
AAGAATCTTAACATGCGGACTTTCCTGCTAGCAAAGAACATTGTGGAGCCGGCTCAAGCA
GCACAACAGGCAGCTCGGTGA

Protein

167 aa

>Os07t0222300-02 Similar to Eukaryotic initiation factor 3e.
VIQQEQHSYKDPITEFLECLYVNYDFDGAQQKLIECEQVILNDPFLGKRIEEGNFVTVPL
RDEFLENARLFIFETYCRIHRCIDIGMLSQKLNMSYDEAELWIMNLVRNSKLDAKIDSVS
GTLIMTTNHVNIHEQVIESLKNLNMRTFLLAKNIVEPAQAAQQAAR*

5'UTR

chr07:6765346..6765347 (- strand) : 2 bp

CDS

chr07:6765232..6765345 (- strand) : 114 bp

chr07:6764634..6764776 (- strand) : 143 bp

chr07:6764108..6764245 (- strand) : 138 bp

chr07:6763867..6763972 (- strand) : 106 bp

3'UTR

chr07:6763626..6763866 (- strand) : 241 bp

FASTA

>Os07t0222300-02 class=Sequence position=chr07:6763626..6765347 (- strand)
AAGTCATTCA GCAGGAGCAG CACAGCTACA AGGATCCCAT CACTGAATTC TTGGAATGCT TGTATGTTAA CTATGATTTT
GATGGTGCAC AACAGAAACT CATAGAGTGT GAGCAGGTAT GTTAGCATGT TTTGAACCTT TTGTCCATCC CATCACTATT
TTTTTTAACT TGGTGCATTA CTAAATATGA TATGAAAACA TTGAAAGACA ATTTCTCCTC ACTTTTTTTT TTGGCAAAAC
ATCCTTTTCC TATATGAATT TTCACTTGCT AGTTCTGTCC TCCGACTAAA ATATTTTATG TTTGGCAAGG CAAAGTTCAC
CTCTGACATC CTTATATCTC TGAGGCCTAT GTGGGGGGTT CCTGGCATGT ATATATTTCT GGAGTTGAAC ATTAGCTTAT
TGTTGTTACT TTATTTTATG TTTTTCCTCA AATGATAACT GTTTCTCTGG GCATAGCTAT GATTTTGCAT TACCAAATTT
TGGGCTATTT CTGTATTATT GTCTTCTCAA TGGTGATCAT ACTGTTACAT AACAATCTTG CATTTATCTG TTCTAATGGC
TACCTTTGTA GGTCATATTG AATGATCCTT TCCTTGGAAA GCGCATTGAG GAAGGGAATT TTGTCACTGT TCCTTTGAGA
GATGAATTCC TTGAAAATGC TCGTCTGTTT ATCTTTGAAA CTTACTGCCG TATTCATCGG TGCATTGATA TTGGGTAGGT
GTTTCTGTCA ATATACTAAT TTTTTTTTTG CTGACATGAA AAAAAGTTCA CTAAGACGAA TGGTAGAAAT TGTAGTTATA
CATTATCATT TCAATAATCA TGTGTCGGAT ATAAGTTGGT TCTGTACCTT GCTTGGGCTT GCATTGTTTT CCAATCAACT
GCTTTCCATG TTATAGGGAA TACTCAATGT TTATCAGCAA AAAACTGTAT CATTACTTTA TTTTAGTTGC CGTTGCATCT
CTGTTCTGTC TTCTCAGTTA GAAATAGTTT TACTAAATTT GCACACGTTT TATATAGGTT TATTCTTCAT ATTATATGGA
CCATGCAGGA ATACAGTTTC TTTCATATCT AAGATGTTCT TCCAATGTTT TGCAATGAAC AGCATGCTTT CTCAGAAGCT
GAACATGAGC TACGATGAGG CAGAATTGTG GATTATGAAC TTAGTTAGGA ATTCAAAGCT CGACGCCAAG ATTGATTCAG
TGTCTGGAAC TCTTATCATG ACGACCAATC ATGTTAACAT GTAAGTTGCT CAGGCCATAC ATGCTGCGAG TATATGCCAG
TTCATGCTAT GTGCTTTTTA ACTCATTAAA GCTATGGTTG ACCTAAGCTT TCGACAATGC GATTGAATCT AATTAATCAT
TTATTCATGT TGCAGCCATG AGCAGGTTAT CGAAAGCTTA AAGAATCTTA ACATGCGGAC TTTCCTGCTA GCAAAGAACA
TTGTGGAGCC GGCTCAAGCA GCACAACAGG CAGCTCGGTG AGATTGACAG AGAAGACCAC AGTTTTGAGG CGCCCGGAAT
TATTTAAGTA GAGACAATCC TCTAAACTTT TGGAGTTTTG TTGTTTAGCA TTGACTCCGT TATCAGTACC TAAGATCATC
TAGGAGGTGG TTTCTCGTTC GCTACAGCAT ATGCCGACGT TTTCTTTCTA TTTTGTACTT GGAATCCTGT GGCTGAAGTT
AATCCTTTCG TTGGTACTAC AATCAAGTAT TACCTGATTG TT

Locus: Os07g0222300

Loading...

Locus: Os07g0222300

Loading...