Os07t0223100-01

Locus

Os07g0223100

Description

Similar to ADP-ribosylation factor 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ARFA1C

CGSNL Gene Name

ADP-RIBOSYLATION FACTOR A1C

Oryzabase Gene Symbol Synonym(s)

OsARFA1c, ARFA1c

Oryzabase Gene Name Synonym(s)

ADP-ribosylation factor A1c

Transcript Evidence

AK243518 (DDBJ, Best hit)

Protein Evidence

NP_001147310.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: intracellular protein transport (GO:0006886)

Biological Process: small GTPase mediated signal transduction (GO:0007264)

Biological Process: protein transport (GO:0015031)

Cellular Component: intracellular (GO:0005622)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Small GTPase superfamily, Rab type (IPR003579)

Small GTP-binding protein domain (IPR005225)

Small GTPase superfamily, SAR1-type (IPR006687)

Small GTPase superfamily, ARF/SAR type (IPR006689)

Small GTPase superfamily, ARF type (IPR024156)

Full-length cDNA

J100075G09 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0223100-01)

Others

Oryzabase (21005)

KEGG (Os07t0223100-01)

Transcript

967 bp

>Os07t0223100-01 Similar to ADP-ribosylation factor 1.
ACCCCCGAAATTTTCCATCGGAAATCCCACCCCGCCTCTCCCTCCCTCTCCCGCAGATCA
GATCAGATCAGATCCGATCAGGTGAAAAAGAGGAGGGGGGAAAGATGGGGTTGGCGTTCG
GGAAGCTGTTCAGCCGGCTGTTCGCGAAGAAGGAGATGCGGATCCTGATGGTCGGTCTCG
ACGCCGCCGGAAAGACCACCATCCTCTACAAGCTCAAGCTCGGCGAGATCGTCACCACCA
TCCCCACCATTGGGTTCAACGTTGAAACTGTTGAGTACAAGAACATTAGCTTCACTGTTT
GGGATGTCGGGGGTCAGGACAAGATCAGACCTCTTTGGAGGCATTACTTCCAGAACACAC
AGGGTCTTATCTTTGTTGTTGATAGCAATGATCGGGACCGTGTTGTGGAAGCTAGAGATG
AGCTCCACAGGATGCTGAATGAGGATGAGTTGCGTGATGCTGTTTTGCTTGTGTTTGCCA
ACAAGCAAGATCTTCCAAATGCTATGAATGCTGCTGAGATCACTGATAAGCTTGGACTGC
ACTCCCTTCGCCAGCGACACTGGTACATCCAGAGCACTTGTGCCACAACTGGTGAGGGTC
TGTACGAGGGCCTGGATTGGCTGTCCAGCAACATTGCTAGCAAGGCTTGAGGCTTGGAAC
TCCGACCGTAAAACTTCGAGCTGACTAGGAGCTATGCATGTATCTCATTCATACGTAGGA
CGAACACTGTTTCAATCTTGTTAGGTGTCTTCGGCAAGCCCAATATTTTTGTAATGATAC
CTCACTCCATCGTTATCTTCTCCGTATTATTTGTACCTACCCCAACCTGTGGTCGTTTTG
CACAAGGATTTGCAGTATGATGTTCCCGTGGGCATGTTGTGATGAACCTGTCCAATACCT
TACTACACATTCTACCAGCTTTTTGCTACAAAACATATATTGCTGCTCATAGGATTTGAT
GAATGCC

CDS

546 bp

>Os07t0223100-01 Similar to ADP-ribosylation factor 1.
ATGGGGTTGGCGTTCGGGAAGCTGTTCAGCCGGCTGTTCGCGAAGAAGGAGATGCGGATC
CTGATGGTCGGTCTCGACGCCGCCGGAAAGACCACCATCCTCTACAAGCTCAAGCTCGGC
GAGATCGTCACCACCATCCCCACCATTGGGTTCAACGTTGAAACTGTTGAGTACAAGAAC
ATTAGCTTCACTGTTTGGGATGTCGGGGGTCAGGACAAGATCAGACCTCTTTGGAGGCAT
TACTTCCAGAACACACAGGGTCTTATCTTTGTTGTTGATAGCAATGATCGGGACCGTGTT
GTGGAAGCTAGAGATGAGCTCCACAGGATGCTGAATGAGGATGAGTTGCGTGATGCTGTT
TTGCTTGTGTTTGCCAACAAGCAAGATCTTCCAAATGCTATGAATGCTGCTGAGATCACT
GATAAGCTTGGACTGCACTCCCTTCGCCAGCGACACTGGTACATCCAGAGCACTTGTGCC
ACAACTGGTGAGGGTCTGTACGAGGGCCTGGATTGGCTGTCCAGCAACATTGCTAGCAAG
GCTTGA

Protein

182 aa

>Os07t0223100-01 Similar to ADP-ribosylation factor 1.
MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATTGEGLYEGLDWLSSNIASK
A*

5'UTR

chr07:6809283..6809363 (+ strand) : 81 bp

chr07:6809644..6809666 (+ strand) : 23 bp

CDS

chr07:6809667..6809814 (+ strand) : 148 bp

chr07:6810606..6810676 (+ strand) : 71 bp

chr07:6810912..6811031 (+ strand) : 120 bp

chr07:6811498..6811616 (+ strand) : 119 bp

chr07:6811889..6811970 (+ strand) : 82 bp

chr07:6812098..6812103 (+ strand) : 6 bp

3'UTR

chr07:6812104..6812420 (+ strand) : 317 bp

FASTA

>Os07t0223100-01 class=Sequence position=chr07:6809283..6812420 (+ strand)
ACCCCCGAAA TTTTCCATCG GAAATCCCAC CCCGCCTCTC CCTCCCTCTC CCGCAGATCA GATCAGATCA GATCCGATCA
GGTAAGCTCC CCCCTCCTGC CTCTCCCTTC CCGGCGATCC ATCCGCCGCC CCGCTGTTCG TGTCCGTCAC CCGATGATTC
TACTGGATCC GCCGTTTCTC GCTTCTCTAG ATTTCGATCG CTGATGTGTG GGGGCGAAGA TCCGGTGCCA TTTGTTCGAG
ATTTGATCTG GGTTTCGAGC CGTTAGGGCG TGGGGGGGAT CATTGGGTGG GTTTCGGTGG GGAGGGAGGT TGGATCTCGT
GCGGATTTGT ATTTAACGGA TGAGATCGTA TGGATTTGCA GGTGAAAAAG AGGAGGGGGG AAAGATGGGG TTGGCGTTCG
GGAAGCTGTT CAGCCGGCTG TTCGCGAAGA AGGAGATGCG GATCCTGATG GTCGGTCTCG ACGCCGCCGG AAAGACCACC
ATCCTCTACA AGCTCAAGCT CGGCGAGATC GTCACCACCA TCCCCACCAT TGGTCAGCCA CATGCGTTTC TTTTTATATT
ATGTTATACT TATTTCCTAG AATTTAGCTT CGTGTGTTGC CGACCACATT CCCTAATTGG ATATGGAATG ATGCATTTCC
TACTGCATTT TCCATGTATA CATTATTTGA TCCAGATATA TAACGTGATG ATAAACGTTT ATAAGTGCTT AATTGATTTG
GATGTCCTGA CAATTCCAAT ACCAATGGTG CTGAATTTCA GAGTTGCCGC CTGAGACCTG AGTACCCACC AAGTCCATGC
TGAAAAGCTA AATCACATAT TACGTCGATT ACATTCTCAA CCATTTTTCT TAGTGATGCT GATCATCTCT GTTCTTGGAT
GCCCCCCAAA AAGATTGCTA TCGGGTCTCC TGGTGCCCCC ATTTCTGAAC CATGTTATGA ACTTTTGTTT GGGGAGGCAT
AATTAACATT TCTTGTACAC TTCAAAATTA GGCTTTCATG CATAGATATG TTATATTTTC TTCCATACCT GAAAACCTGG
GTTGAATAAT TGCGTGGAAG AAAAGCATAA TATTGTGACT TCTGTCATCT ATGTAAAATT AAGAGTCAGC ATTCCGTGTC
CAATATCATC TTTAATTGAT GGAGTGCCTT TATTGGTTGT CAGCTTAATT TAGGCAACAA AATTTGGACA ACGAATAGTC
GGTAGGCATT AAGTGTGATC TCCCTCTCCC TTCTGTACTT AATTGATGGT ACAATCTTAA CGTTTCCATT TCTATTTCTG
TATCTTTGAT CTTTCTGATT TAATAGTTAC CTTTGCCATA CAGGGTTCAA CGTTGAAACT GTTGAGTACA AGAACATTAG
CTTCACTGTT TGGGATGTCG GGGGTCAGGA CAAGGTATGC TGTAATATTT TGATCCTACA TTATTGATTG TTATAATCTG
TTTGATGCTA TATTACCACT TTTTTTTACT GTTGGCATGT AGTTTCCTAG TGATCTATTT AAAAATAAAT AAATTAATCG
ATCAGATTAC TATGAAAATT TCAGACCAGT TGGTCCTTTG TCTTGACCTA TTTTAATTTC AAAACTATCT GGAGTGTTGT
CTAACTTAAT GCCTGTGCGT CTGAAACAGA TCAGACCTCT TTGGAGGCAT TACTTCCAGA ACACACAGGG TCTTATCTTT
GTTGTTGATA GCAATGATCG GGACCGTGTT GTGGAAGCTA GAGATGAGCT CCACAGGATG CTGAATGAGG TAAATCGATT
TTTTCTGTGT TTTTATGTGG TGCTGTAATT CTACCATGTA TCAGTTAACT CATGAATTAT TCCACTAGTA TTAACATCCA
TGATATGCGA ATTGATTAGC AAAGCAACCC TTTACTTCTT TAGTTCAATC CTGTGGAACT TCAGAAAATA ATGACAAATG
AAACTACTGC ATCAATGTAC ATAAGATTTA CTAATTTATT TACTGTAAAG CTATTCTATA TTCCACATTT CTTTTGGGGA
AAATTTCTTC ACTAGAGCCA AGTGAAAAGG GCTCATATCC AGGAGAATCC CATTGAGTAG CTGCTAGTTG TCATGCATTT
ATTTTCTTTA GGATGGGAAA TATTATCTTT GTTGCAGACA CTGTTGTAGA AAACAAGCAT TTCATCAGTT GACAAATTGA
CAAACTCTTT TGCAAGTTGC AACCATGTAT AATGATCAAC TGAAATTTAT GGCAGGATGA GTTGCGTGAT GCTGTTTTGC
TTGTGTTTGC CAACAAGCAA GATCTTCCAA ATGCTATGAA TGCTGCTGAG ATCACTGATA AGCTTGGACT GCACTCCCTT
CGCCAGCGAC ACTGGTAAAT AAGGACCACC AATGGATTCT TGCCCTTATA TATTGTTTTT GCTGTGGATA TAGCTTGAAG
CTCTCCAATA AGCGAATACA ATACTATTTT AAATTCATTG TATCCTGCAT CTGGATTGTG ATTCATAGTT TTTTTTTACC
ATTGATGTAA CTCACTGCCT CACTTTTCCC TTGGATACTC TTGTATTCAT TATATCCTGC ATCTAGAAAC TAGAATGCGA
CGCATGGTTT TATATTCTTG ATCTAAATCT GTTTTCTTCC TCACAGGTAC ATCCAGAGCA CTTGTGCCAC AACTGGTGAG
GGTCTGTACG AGGGCCTGGA TTGGCTGTCC AGCAACATTG CTAGCAAGGT ACCTCATTAT CATTTTAGTT CTGTCATTTC
TGGAGATTAT TCCGATAATA GGCTAGTAAA ATTGTTTCCT GTTCAAAGTT CTAATGTATA TACTTGTTTG GCCTTTTCTT
TGCTGTTGTG CACAGGCTTG AGGCTTGGAA CTCCGACCGT AAAACTTCGA GCTGACTAGG AGCTATGCAT GTATCTCATT
CATACGTAGG ACGAACACTG TTTCAATCTT GTTAGGTGTC TTCGGCAAGC CCAATATTTT TGTAATGATA CCTCACTCCA
TCGTTATCTT CTCCGTATTA TTTGTACCTA CCCCAACCTG TGGTCGTTTT GCACAAGGAT TTGCAGTATG ATGTTCCCGT
GGGCATGTTG TGATGAACCT GTCCAATACC TTACTACACA TTCTACCAGC TTTTTGCTAC AAAACATATA TTGCTGCTCA
TAGGATTTGA TGAATGCC

Locus: Os07g0223100

Loading...

Locus: Os07g0223100

Loading...