Os07t0227800-00

Locus

Os07g0227800

Description

Similar to ubiquinone biosynthesis protein ubiB.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

ABC1 family domain containing protein

Transcript Evidence

EU966367 (DDBJ)

Protein Evidence

B6TN02 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

ABC-1 (IPR004147)

Protein kinase-like domain (IPR011009)

Expression Databases

TENOR (Os07t0227800-00)

Others

Oryzabase (21867)

KEGG (Os07t0227800-00)

Transcript

1864 bp

>Os07t0227800-00 Similar to ubiquinone biosynthesis protein ubiB.
TGCTCTCTCTCTCTCTCTCTTCACGCTTCCCACGCGCGACACGAGGTTGGAGACGCGTCC
CGTGACGTCATCGTCGTCCCCGACTCCGGCGAGCCCCGCACCCATGGCGGCGGCGGCCGC
GAGGGGCGCCGCCGCGGCCCGCTCCCCGCTCGTCCTCCACCGCCACCCCCACCCCGCGCA
CCACCGCCGCCTCCGCCTCCTCCCCCTGGCTCGCCCCCGCGTGTGGGGAGGAGGATCAGG
GCCAGCCGGGAGAAGGGGCGGCGGGTCGGGATTAGGGTTTTCGCGAGGTACAGCCAGGCC
CAGGACTTCTCCACTCGCCTCCAAGATAGAGCTGGCGAATTGCCTAAGTTGGTTGAGGAC
CTTCTACAGACATCAATTAGCACAGGGCCACGAGGTGCTTTTAGGTTTGCCCAAGGGATC
CAAGCTGTCCTTGGGGTTGGTGGGGAGTGGCTAAATGACTTCTCAAAGACAGCCAACACA
TCAGCAGGAATACCAGCTCAGATGCAGCTGGGTTTGCTTTCTCCTCTTTATCTTAGAAGG
CTTTTTGAGCGCATGGGTGCAACTTATATCAAGCTAGGTCAGTTCGTAGCTTCTGCACCA
ACTTTGTTTCCTGCAGAGTATGTCGAGGAATTCCAGAACTGTTTTGACCGTGCACCACCT
GTTCCATATAGTGAGATTGAGTCAATATTGCGTGAGGAGTTGCAACAGCCGTTGGATAGT
GTATATGAATACATTGATCCAGTTCCAATAGCTTCTGCGTCAATAGCACAGGTTCATGGG
GCAAGGTTGAAGAGCTCTCAGAAGGATGTGGTTATCAAGGTCCTCAAGCCTGGTATTGAA
GACACTTTGGTGGCTGACCTGAATTTTATCTATGTTGTTGCACGTATTTTGGAATTTCTA
AACCCTGAACTACAGAGGACATCACTGGTAGGAATTGTCAAGGATATAAAGGAATCTATG
CTTGAAGAAGTTGATTTCAGGAAAGAGGCTATGAATATTGAGGCTTTTCAGAGGTACATC
GATGCAATGGGATTTGACAGGCAGGCCAAAGCCCCTTTTGTGTATCGCCACTGTAGCACA
AAGCGTGTCCTAACTATGGAAAGATTGTACGGTGTTCCACTCACTGACCTTGATTCTATA
AGGTCTCTTGTTCCTGATCCTGAGCTGACTTTAGTCACTGCACTTAATGTCTGGTTTGGA
AGCTTGATTTCATGTGAATCCTTCCATGCAGATGTGCATGCAGGAAATTTATGGTTGCTC
CGAGATGGACGTGTTGGATTTCTTGATTTTGGAATTGTTGGCCGGATATCGCCAAGGACC
TGGGCTGCAATGGAGGTCTTTTTGGCTTCATTTGCAACTGACGATTATAATGCTATGGCA
TCAGCCCTTTCTGAAATGGGTGCTACAGGGAATGATATAAATGTTAATGAATTTGCAAAG
GACTTGGAAAAAATATTCTCATCAATACAGGATTTGGATACTGAAGTCATAGTTGCAACA
GCAAGAACTCCTGATGCTACAGCAGTATCGGCTAATGTTGTCGTTGACGAGAGACAGATG
AATGCATTGTTTCTTGATCTGGTGAGGGTCAGCGAGTCGTATGGATTGAAATTTCCTCGC
GAATTCGCTCTTCTGATGAAGCAGCTTCTGTATTTTGATCGCTACACAAGATTGTTGGCT
CCCAGCATGAACATGCTGCGAGATGAGAGGGTTAACATTAGCTCCCGCCAACAGGCCAGA
AGAGTAGATCGTTTCCAGTGACCGATGCTTGTGATACACTGACAAGTAGTACGTAACAAG
CTCGTGTAAGTGTAACCTACTAACTGTATATATTTTCACCAGATCAACATAGGAATGAAC
CGCA

CDS

1761 bp

>Os07t0227800-00 Similar to ubiquinone biosynthesis protein ubiB.
TGCTCTCTCTCTCTCTCTCTTCACGCTTCCCACGCGCGACACGAGGTTGGAGACGCGTCC
CGTGACGTCATCGTCGTCCCCGACTCCGGCGAGCCCCGCACCCATGGCGGCGGCGGCCGC
GAGGGGCGCCGCCGCGGCCCGCTCCCCGCTCGTCCTCCACCGCCACCCCCACCCCGCGCA
CCACCGCCGCCTCCGCCTCCTCCCCCTGGCTCGCCCCCGCGTGTGGGGAGGAGGATCAGG
GCCAGCCGGGAGAAGGGGCGGCGGGTCGGGATTAGGGTTTTCGCGAGGTACAGCCAGGCC
CAGGACTTCTCCACTCGCCTCCAAGATAGAGCTGGCGAATTGCCTAAGTTGGTTGAGGAC
CTTCTACAGACATCAATTAGCACAGGGCCACGAGGTGCTTTTAGGTTTGCCCAAGGGATC
CAAGCTGTCCTTGGGGTTGGTGGGGAGTGGCTAAATGACTTCTCAAAGACAGCCAACACA
TCAGCAGGAATACCAGCTCAGATGCAGCTGGGTTTGCTTTCTCCTCTTTATCTTAGAAGG
CTTTTTGAGCGCATGGGTGCAACTTATATCAAGCTAGGTCAGTTCGTAGCTTCTGCACCA
ACTTTGTTTCCTGCAGAGTATGTCGAGGAATTCCAGAACTGTTTTGACCGTGCACCACCT
GTTCCATATAGTGAGATTGAGTCAATATTGCGTGAGGAGTTGCAACAGCCGTTGGATAGT
GTATATGAATACATTGATCCAGTTCCAATAGCTTCTGCGTCAATAGCACAGGTTCATGGG
GCAAGGTTGAAGAGCTCTCAGAAGGATGTGGTTATCAAGGTCCTCAAGCCTGGTATTGAA
GACACTTTGGTGGCTGACCTGAATTTTATCTATGTTGTTGCACGTATTTTGGAATTTCTA
AACCCTGAACTACAGAGGACATCACTGGTAGGAATTGTCAAGGATATAAAGGAATCTATG
CTTGAAGAAGTTGATTTCAGGAAAGAGGCTATGAATATTGAGGCTTTTCAGAGGTACATC
GATGCAATGGGATTTGACAGGCAGGCCAAAGCCCCTTTTGTGTATCGCCACTGTAGCACA
AAGCGTGTCCTAACTATGGAAAGATTGTACGGTGTTCCACTCACTGACCTTGATTCTATA
AGGTCTCTTGTTCCTGATCCTGAGCTGACTTTAGTCACTGCACTTAATGTCTGGTTTGGA
AGCTTGATTTCATGTGAATCCTTCCATGCAGATGTGCATGCAGGAAATTTATGGTTGCTC
CGAGATGGACGTGTTGGATTTCTTGATTTTGGAATTGTTGGCCGGATATCGCCAAGGACC
TGGGCTGCAATGGAGGTCTTTTTGGCTTCATTTGCAACTGACGATTATAATGCTATGGCA
TCAGCCCTTTCTGAAATGGGTGCTACAGGGAATGATATAAATGTTAATGAATTTGCAAAG
GACTTGGAAAAAATATTCTCATCAATACAGGATTTGGATACTGAAGTCATAGTTGCAACA
GCAAGAACTCCTGATGCTACAGCAGTATCGGCTAATGTTGTCGTTGACGAGAGACAGATG
AATGCATTGTTTCTTGATCTGGTGAGGGTCAGCGAGTCGTATGGATTGAAATTTCCTCGC
GAATTCGCTCTTCTGATGAAGCAGCTTCTGTATTTTGATCGCTACACAAGATTGTTGGCT
CCCAGCATGAACATGCTGCGAGATGAGAGGGTTAACATTAGCTCCCGCCAACAGGCCAGA
AGAGTAGATCGTTTCCAGTGA

Protein

587 aa

>Os07t0227800-00 Similar to ubiquinone biosynthesis protein ubiB.
CSLSLSLHASHARHEVGDASRDVIVVPDSGEPRTHGGGGREGRRRGPLPARPPPPPPPRA
PPPPPPPPPGSPPRVGRRIRASREKGRRVGIRVFARYSQAQDFSTRLQDRAGELPKLVED
LLQTSISTGPRGAFRFAQGIQAVLGVGGEWLNDFSKTANTSAGIPAQMQLGLLSPLYLRR
LFERMGATYIKLGQFVASAPTLFPAEYVEEFQNCFDRAPPVPYSEIESILREELQQPLDS
VYEYIDPVPIASASIAQVHGARLKSSQKDVVIKVLKPGIEDTLVADLNFIYVVARILEFL
NPELQRTSLVGIVKDIKESMLEEVDFRKEAMNIEAFQRYIDAMGFDRQAKAPFVYRHCST
KRVLTMERLYGVPLTDLDSIRSLVPDPELTLVTALNVWFGSLISCESFHADVHAGNLWLL
RDGRVGFLDFGIVGRISPRTWAAMEVFLASFATDDYNAMASALSEMGATGNDINVNEFAK
DLEKIFSSIQDLDTEVIVATARTPDATAVSANVVVDERQMNALFLDLVRVSESYGLKFPR
EFALLMKQLLYFDRYTRLLAPSMNMLRDERVNISSRQQARRVDRFQ*

CDS

chr07:7157798..7158005 (- strand) : 208 bp

chr07:7157527..7157643 (- strand) : 117 bp

chr07:7156975..7157117 (- strand) : 143 bp

chr07:7156555..7156668 (- strand) : 114 bp

chr07:7155975..7156163 (- strand) : 189 bp

chr07:7155739..7155894 (- strand) : 156 bp

chr07:7154535..7154800 (- strand) : 266 bp

chr07:7154323..7154420 (- strand) : 98 bp

chr07:7153958..7154136 (- strand) : 179 bp

chr07:7153429..7153539 (- strand) : 111 bp

chr07:7153067..7153246 (- strand) : 180 bp

3'UTR

chr07:7152964..7153066 (- strand) : 103 bp

FASTA

>Os07t0227800-00 class=Sequence position=chr07:7152964..7158005 (- strand)
TGCTCTCTCT CTCTCTCTCT TCACGCTTCC CACGCGCGAC ACGAGGTTGG AGACGCGTCC CGTGACGTCA TCGTCGTCCC
CGACTCCGGC GAGCCCCGCA CCCATGGCGG CGGCGGCCGC GAGGGGCGCC GCCGCGGCCC GCTCCCCGCT CGTCCTCCAC
CGCCACCCCC ACCCCGCGCA CCACCGCCGC CTCCGCCTCC TCCCCCTGGT CAGTCACTCC GCCCCCGTCT CATTTCCTCC
TCGATCTCTA GCTCCCTCCT CTTGGGAGTA GGCGGGATTG GGAGCTACCT ACCTCGTGCT TGATTGAGGT GGTAATTCGG
TCAACTACTG ATTGGGGTTG CAGGTGGCGG GCGGCGGGGG AGGCTCGCCC CCGCGTGTGG GGAGGAGGAT CAGGGCCAGC
CGGGAGAAGG GGCGGCGGGT CGGGATTAGG GTTTTCGCGA GGTACAGCCA GGCCCAGGAC TTCTCCACTC GCCTCCAAGG
TAATCGATTG GTTGATTTCT TTCCCCATCT CTGTATAATT CGATTTGGTA CTTGGTTCAA AGCCACTGTT TAGGCCCAGC
TTAGTTGAAC ATTTGAACAA GCGACTGTTT CTCATTAGGC AGGATACGGG TGATGATGTA ATATGAAGCG AGAATTTCCG
GTGTGGATTT TCACGAGTCG TGAGTTTGTT TTCTGTTCAT CGCAGTAGCA TAGAGAATGT TATGTATTTT GGGATTCGGG
TGGGTAAAAT GTGTGTCTCT TCAGATTAAT GTACTCCTTA TTAACATTCC TCACAAAAAT AAGTAGTTAT GAACAATCTT
GGGATAGCTA GATCACAGAT GCATTGAATA TTAAGTTTGT TTGTTCTTCG CAAAATCATC CCATGTCTTT GATTTCGTTC
AAATGCAGAT AGAGCTGGCG AATTGCCTAA GTTGGTTGAG GACCTTCTAC AGACATCAAT TAGCACAGGG CCACGAGGTG
CTTTTAGGTT TGCCCAAGGG ATCCAAGCTG TCCTTGGGGT TGGTGGGGAG TGGCTAAATG ACTTCTCAAA GGTTATTTCT
TGTTTGTGTT ATTCATCTAT TTTGTCTAAA AACTTGATCT TAGAATTTCT GAGAACTGAA ACAATGGAAG CAGCTGTAGA
CTGAACTACT AATGAACTAC TGATGTGTTG AGTTGGCTGA GGTTGTATGG GAGAATATTG GGGATTTAGG GCTAGTCTAG
ATGTGGATTT TTCATCTATG TAGAAAAGAG GAGGTTAAAT TTTTGTTGGT GCACAATGAC CAGGTTTATC TAAGATATTT
TTTTTATTGA TAACTTTGGT TTCAGAAGCG TAATATCCTG CTGTTAATAT GATGCAGACA GCCAACACAT CAGCAGGAAT
ACCAGCTCAG ATGCAGCTGG GTTTGCTTTC TCCTCTTTAT CTTAGAAGGC TTTTTGAGCG CATGGGTGCA ACTTATATCA
AGCTAGGTCA GGTAAGGACA TGTTCATACT TTGCGGTTTA TGCTATCATC AACTACAAAA TGTGTCCATC TCAAAAGAAA
AAATAAACTA CATGTGTATG TGTTCCTTAA TTAATAGATT GTCTTGAATT TCTTAATCTT CTGTACCTTT TGAAAGAAAT
GCCAGAATTC TTCATTTTAC TTTGTATATG TAGCAAACAG AAACAAAGAC CACTAATATA TCTTTCAGCA ACCCAGACAA
TAGTCAGTTG CTTACTTGTC ACTAGACAGG TAGAGTAACC TATCTTTAGA GTGGTCCTTT GGGATGGGCA AAGGGAGAGG
AGTTAAAATA GTTATTCAGT TTAATAGTCA TATATTTTAT GATTATTTCA ACCTGGATAG TCAACTGACT GTGGTGGTGC
AGTTCGTAGC TTCTGCACCA ACTTTGTTTC CTGCAGAGTA TGTCGAGGAA TTCCAGAACT GTTTTGACCG TGCACCACCT
GTTCCATATA GTGAGATTGA GTCAATATTG CGTGAGGAGT TGCAACAGCC GTTGGATAGT GTATATGAAT ACATTGATCC
AGTTCCAATA GCTTCTGCGT CAATAGCACA GGTTTCTGTT GAGACCATCA GAAGTTCTGG ACTATTTGTT GTCTGGAGCT
AAAGCACTGA TATAACTTTA TTCTTATCCA GGTTCATGGG GCAAGGTTGA AGAGCTCTCA GAAGGATGTG GTTATCAAGG
TCCTCAAGCC TGGTATTGAA GACACTTTGG TGGCTGACCT GAATTTTATC TATGTTGTTG CACGTATTTT GGAATTTCTA
AACCCTGAAC TACAGAGGAC ATCACTGGTG AGTTATCGCC TAATGAGTCT TTCACTGGAC AGGATTTTTT TCATTCATTG
AACAATCACT GGTCCTGGTG GTTCTCGGAG CGCAGGAAAC CAAAATTTAC TGCTTTCTTT AGTATAATCA GAAGCCAGAA
GGTCAAAATA TATTTTTGTT TGATTCCTGT ATGCAGCAAG CAATGCATGC CATGAAATTG CTCCCATGAC CATGAGGATA
TGTTTTTCTT TTGGTAGTTG AGGCAAGATC ATTGAACTTT TCACAGTTGA TTTACATGTA TTTTTCAATT CTAGCCACTG
TGCTAGAGTT GGCACAATTA GGTGCAGAAA CTTTTAATAT CTATATCCTT AAAATTTATT AGTTGGATTG AAGGCACCAC
AATATTCCTA AGATCAGAAA AAATATGAGT TTAAAAGATT AACAGAAAAT TCAGAAAATT CTCCCAATAA TCAAGAGAGA
AAGAAATGTC TTGCCACTTG CGTGTTGTTT TGATGGACCT AGATTGTAAC CTAGTAGATT AACTATAGTT GTTATAGTTG
TGTAACAAAT ACAACTGCAC CTCTAATCAT TGATATAAGA GCTTTATAGC AAATGGAATT ATTGTTAAAT GTAATCATGC
AACTGCATGG ATATCCCACT AAAAAATTGA ATATCGAATA AGGAATATTT CATGGTGGAG CACAATATAT CTTGAGCTTG
TGACATGAGG AGTTGACTAT ATATATTATT CACGTACTAT AACTAAAAAG GAAAAAAAAC AATTAGTTCA CACAACCAGA
AACAAATGAA TACTTTATAC TTTGTAGTTC ATATATGTGG AAGTAGAGAC AGCATATAGC AATCATGAAA TTTTCTGTAT
ACTTGGTTAT CCAAATTTTG TGGTATCACA AGTTATAGAA GAATATAATA AGAGATGTCC TTATGCTCAG AATTTTATAT
TATAGGTAGG AATTGTCAAG GATATAAAGG AATCTATGCT TGAAGAAGTT GATTTCAGGA AAGAGGCTAT GAATATTGAG
GCTTTTCAGA GGTACATCGA TGCAATGGGA TTTGACAGGC AGGCCAAAGC CCCTTTTGTG TATCGCCACT GTAGCACAAA
GCGTGTCCTA ACTATGGAAA GATTGTACGG TGTTCCACTC ACTGACCTTG ATTCTATAAG GTCTCTTGTT CCTGATCCTG
AGCTGACTTT AGTCACTGCA CTTAATGTCT GGTATGCTCC ATGCGTCCTT GTGATTCCAT ACATCATATA TTTGGGTATT
TCTGCCATTC ATTGCCTTAT TCAATCCTCA GAATAGGCAT GTTGACATAT GTGCAAAATG TGCAGGTTTG GAAGCTTGAT
TTCATGTGAA TCCTTCCATG CAGATGTGCA TGCAGGAAAT TTATGGTTGC TCCGAGATGG ACGTGTTGGA TTTCTTGATT
TTGGTATGTA ACATATTCTC CAATCTCCAC GGTGGCACGG TTGCTCTATA TCTCATTAGG CAATTTAGGA TGCACCTTGT
ATTTGCTAAA AAAGGAAATA TTCTGGCCTT TTAATTCTTA CATTATCTAT TAGTCAAAAC ACAAAGTGGT CAAGAAAGTT
TATCACTATT GGTTAATACC ATTTCACAGG AATTGTTGGC CGGATATCGC CAAGGACCTG GGCTGCAATG GAGGTCTTTT
TGGCTTCATT TGCAACTGAC GATTATAATG CTATGGCATC AGCCCTTTCT GAAATGGGTG CTACAGGGAA TGATATAAAT
GTTAATGAAT TTGCAAAGGA CTTGGAAAAA ATATTCTCAT CAATACAGGT AATATTTCCC AAAATAGTAG GTTATTTGAT
GTCATGAAGG CCTGGTTATC CCGTGAACAT GGTGACCCAA TTTCGACTGT TGAAGTGCCA AAAATGATGC CAGGGTGAAA
CCTGggctgt gtttcacacc aaaattggaa gtttggttaa aattggaacg atgtgacgga aaagttggaa gtttgtgtgt
gtaggaaagt attgatgtga tggaaaagtt ggaagtttga agaaaaactt tggaactaaa cacggcgCTG GTCTGGCAGT
AGTAAAATGC TGAATGCAAG CAAAAGTGGC TTATGGACAG GAATTTTTGT GGCTACTGGC TAGTCAAATT TGGATATCGT
TCTTTAGTTA GTGTTTTACC ACTTATCTCG TGGTTAATTT TCAATTGCAT TCTCATTTGT GCGCAGGATT TGGATACTGA
AGTCATAGTT GCAACAGCAA GAACTCCTGA TGCTACAGCA GTATCGGCTA ATGTTGTCGT TGACGAGAGA CAGATGAATG
CATTGTTTCT TGATCTGGTG AGCTACTTTC TTTTCTCTCT CGGTTAGAAC AAGGTAGAGA GAACTTCTAC CTTATACATT
CGTATCACTG TATGTTCTTG TTGGTAAATG TTGCCTGCCA GCGTGTATTG TTTTCACGAA AGAAGAGAGA TGAGGGAAAA
AAAACAATGC TGACAATTCT GTTGCTCTGC GTCTTCCAGG TGAGGGTCAG CGAGTCGTAT GGATTGAAAT TTCCTCGCGA
ATTCGCTCTT CTGATGAAGC AGCTTCTGTA TTTTGATCGC TACACAAGAT TGTTGGCTCC CAGCATGAAC ATGCTGCGAG
ATGAGAGGGT TAACATTAGC TCCCGCCAAC AGGCCAGAAG AGTAGATCGT TTCCAGTGAC CGATGCTTGT GATACACTGA
CAAGTAGTAC GTAACAAGCT CGTGTAAGTG TAACCTACTA ACTGTATATA TTTTCACCAG ATCAACATAG GAATGAACCG
CA