Os07t0232900-01

Locus

Os07g0232900

Description

Heavy metal-transporting P1B-ATPase, Root-to-shoot cadmium (Cd) translocation

RAP-DB Gene Symbol Synonym(s)

HMA3, OsHMA3, OsHMA3a, OsHMA3n, osHMA3

RAP-DB Gene Name Synonym(s)

HEAVY METAL ATPASE 3, heavy metal ATPase 3, heavy metal transporter 3, heavy metal P-Type ATPase 3

CGSNL Gene Symbol

HMA3

CGSNL Gene Name

HEAVY METAL ATPASE 3

Oryzabase Gene Symbol Synonym(s)

OsHMA3, OsHMA3a, OsHMA3n, osHMA3

Oryzabase Gene Name Synonym(s)

heavy metal ATPase 3, heavy metal transporter 3, heavy metal P-Type ATPase 3, heavy metal P1B-ATPase 3

Transcript Evidence

AB559519 (Genbank)

AB557931 (Genbank)

Protein Evidence

Q8H384 (UniProt)

Literature

PMID: 20840506

PMID: 20823253

Note

Manual Curation

January 6, 2011

Gene Ontology (GO)

Biological Process: ATP biosynthetic process (GO:0006754)

Biological Process: cation transport (GO:0006812)

Biological Process: metabolic process (GO:0008152)

Biological Process: metal ion transport (GO:0030001)

Cellular Component: membrane (GO:0016020)

Cellular Component: integral to membrane (GO:0016021)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism (GO:0015662)

Molecular Function: hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides (GO:0016818)

Molecular Function: metal ion binding (GO:0046872)

Molecular Function: metal ion transmembrane transporter activity (GO:0046873)

Functional domain (InterPro)

ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter (IPR001757)

Haloacid dehalogenase-like hydrolase (IPR005834)

Heavy metal-associated domain, HMA (IPR006121)

ATPase, P-type, heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating (IPR006404)

ATPase, P-type, heavy metal translocating (IPR006416)

ATPase, P-type, ATPase-associated domain (IPR008250)

ATPase, P-type phosphorylation site (IPR018303)

HAD-like domain (IPR023214)

ATPase, P-type, cytoplasmic domain N (IPR023299)

ATPase, P-type, cytoplasmic transduction domain A (IPR023300)

Expression Databases

TENOR (Os07t0232900-00)

Others

Oryzabase (9428)

Transcript

3015 bp

>Os07t0232900-01 Heavy metal-transporting P1B-ATPase, Root-to-shoot cadmium (Cd) translocation
ATGGCCGGAAAGGATGAGGCGGAAGGGCTCGAGGCGAGGCTGCTGCTGCTGCCGCCTGAG
GCGGCGGCGGAGGAGCCGACGAGGTGTGGCGGCGGCGACGGCGGCGGCGGCGGGAGGAAG
CGGAAGAAGACGTACCTTGATGTCCTTGGCGTGTGCTGCTCCGCGGAGGTCGCGCTGGTG
GAGCGGCTGCTCGCGCCGCTCGACGGCGTCCGCGTGGTGTCCGTCGTCGTGGCGTCCCGC
ACCGTCGTCGTCGAGCACGACCCCGCCGCCGCCCCGGAGTCCGCCATCGTGAAGGCGCTG
AACAAGGCCGGCCTCGAGGCGTCGGTGCGAGCCTACGGCAGCAGCGGCGTGGTCAGCCGG
TGGCCGAGCCCGTACATCGTCGCCTCCGGCGTCCTCCTCACGGCGTCCTTCTTCGAGTGG
CTCTTCCCTCCCCTGCAGTgcctggccgtggcggccgtcgtcgccggcgcgccgccgatg
gtgcgccgtgggttcgccgcggcgagccggctgtcgctcgacatcaacgtcctcatgctc
atcgccgtcgccggcgcgctctgcctcggcgactacacggaggccggcgccatcgtcttc
ctcttcaccACCGCAGAATGGCTCGAGACGCTGGCCTGCACAAAGGCGAGCGCCGGGATG
TCGTCGTTGATGGGCATGCTGCCGGTGAAGGCGGTCATCGCGACGACGGGCGAGGTTGTC
AGCGTGCGCGACGTCCGCGTGGGCGACGTCGTCGCGGTCAGGGCCGGCGAGATCGTCCCC
GTCGACGGCGTGGTGGTCGACGGCCAGAGCGAGGTCGACGAGAGGAGCCTCACCGGCGAG
TCCTTCCCGGTGCCGAAGCAGCCGCACTCCGAGGTCTGGGCCGGCACAATGAACTTTGAC
GGTTACATTGCTGTGAGAACTACGGCTCTCGCCGAGAACTCGACGGTGGCGAAGATGGAG
AGGCTGGTGGAGGCGGCGCAGAACAGCAGGTCGAAGACGCAGCGGCTGATCGATTCGTGC
GCAAAGTACTACACGCCGGCCGTGGTGGTTGTTGCAGCAGGAGTGGCCCTGATCCCGGCT
CTGCTCGGAGCAGATGGCCTTGAGCAATGGTGGAAGCTGGCTCTGGTGATGCTTGTGAGC
GCGTGCCCCTGCGCATTAGTGCTGTCGACACCGGTGGCATCCTTCTGCGCAATGCTGCGC
GCTGCGAGGATGGGGATCTTCATCAAGGGTGGAGATGTTCTTGAATCACTTGGGGAGATC
AGGGCCGTCGCGTTCGACAAGACCGGGACGATCACCAGAGGAGAGTTCAGCATCGACTCG
TTCCATCTGGTTGGGGATCACAAGGTTGAGATGGATCATCTTCTTTACTGGATTGCAAGC
ATTGAGAGCAAGTCAAGCCACCCAATGGCAGCTGCACTTGTGGAGTATGCTCAATCCAAA
TCCATCCAACCAAACCCGGAAAATGTGGGCGATTTTCGGATATATCCCGGGGAGGGGATC
TATGGAGAGATCCATGGAAAGCACATCTACATTGGGAACAGAAGGACATTGGCAAGAGCG
TCATCACCTCAGTCAACTCAAGAAATGGGTGAGATGATCAAGGGCGTGTCGATCGGCTAC
GTGATCTGCGACGGCGAGCTCGCCGGCGTCTTCTCGCTCTCCGACGACTGCCGGACCGGC
GCGGCGGAGGCGATCCGGGAGCTTGGATCGCTGGGCATCAAGTCGGTTATGCTGACCGGG
GACAGCAGCGCGGCGGCGACGCACGCGCAGGGCCAGCTCGGCGGCGTCATGGAGGAGCTC
CACTCCGAGCTCCTCCCGGAGGACAAGGTCCGGCTCGTCAGCGGCCTCAAGGCGAGGTTC
GGCCCGACGATGATGGTCGGGGACGGGATGAACGACGCGGCGGCGCTGGCGGCGGCGGAC
GTGGGCGTGTCCATGGGCATCTCCGGGTCGGCGGCGGCGATGGAGACCAGCCACGCGACG
CTCATGTCGAGCGACGTGCTCAGGGTCCCCGAGGCCGTCAGgctcggccggtgcgcccgc
cggaccatcgccgtcaacgtggccggctcggtggccgtgaaggccgccgtgctcgcgctg
gccgcggcgtggcgccccgtgctctgggccgccgtgctcgccgaCGTCGGGACGTGCCTC
CTCGTCGTGCTCAACAGCATGACGCTGCTCAGGGAGGAGTGGAAGGGCGGCGCCAAGGAG
GACGGCGCGTGCCGCGCCACGGCGAGGTCGCTGGTGATGAGGTCCCAGCTCGCCGCCGAC
TCCCAAGCACCCAACGCCGCAGACGCTGGCGCCGCCGGCCGTGAGCAAACGAACGGCTGC
CGTTGCTGTCCGAAGCCGGGCATGTCGCCCGAGCACTCGGTTGTCATCGACATCCGAGCC
GACGGCGAGCGTCAAGAAGAGCGGCCGGCCGAGGCGGCCGTCGTTGCCAAATGTTGCGGC
GGAGGCGGCGGCGAGGGCATCCGCTGCGGAGCCTCCAAGAAGCCAACTGCAACGGTCGTT
GTTGCCAAATGTTGCGGGGGCGGCGGCGGCGGCGAGGGCACCAGGTGCGGCGCGTCCAAG
AATCCGGCAACGGCGGCCGTCGTTGCCAAATGTTGCAGCGGAGGCGGCGGCGAGGGCATC
GGCTGCGGAGCCTCCAAGAAGCCAACTGCAACGGCCGTTGTTGCCAAATGTTGCGGCGGC
GGCGGCGAGGGCACCAGGTGCGCCGCGTCCAAGAAGCCGGCAACGGCGGCCGTCGTTGCC
AAATGTTGCGGTGGCGATGGCGGCGAGGGCACCGGATGTGGTGCCTCCAAGAGGTCGCCG
CCGGCTGAGGGAAGCTGCAGCGGCGGTGAAGGCGGTACCAATGGTGTTGGTCGTTGCTGC
ACGAGCGTGAAGAGGCCAACCTGTTGCGACATGGGAGCGGCGGAGGTGTCCGATTCTTCG
CCGGAGACGGCGAAAGACTGCAGAAATGGGAGGTGTTGCGCGAAGACGATGAACTCCGGT
GAAGTGAAAGGATGA

CDS

3015 bp

>Os07t0232900-01 Heavy metal-transporting P1B-ATPase, Root-to-shoot cadmium (Cd) translocation
ATGGCCGGAAAGGATGAGGCGGAAGGGCTCGAGGCGAGGCTGCTGCTGCTGCCGCCTGAG
GCGGCGGCGGAGGAGCCGACGAGGTGTGGCGGCGGCGACGGCGGCGGCGGCGGGAGGAAG
CGGAAGAAGACGTACCTTGATGTCCTTGGCGTGTGCTGCTCCGCGGAGGTCGCGCTGGTG
GAGCGGCTGCTCGCGCCGCTCGACGGCGTCCGCGTGGTGTCCGTCGTCGTGGCGTCCCGC
ACCGTCGTCGTCGAGCACGACCCCGCCGCCGCCCCGGAGTCCGCCATCGTGAAGGCGCTG
AACAAGGCCGGCCTCGAGGCGTCGGTGCGAGCCTACGGCAGCAGCGGCGTGGTCAGCCGG
TGGCCGAGCCCGTACATCGTCGCCTCCGGCGTCCTCCTCACGGCGTCCTTCTTCGAGTGG
CTCTTCCCTCCCCTGCAGTgcctggccgtggcggccgtcgtcgccggcgcgccgccgatg
gtgcgccgtgggttcgccgcggcgagccggctgtcgctcgacatcaacgtcctcatgctc
atcgccgtcgccggcgcgctctgcctcggcgactacacggaggccggcgccatcgtcttc
ctcttcaccACCGCAGAATGGCTCGAGACGCTGGCCTGCACAAAGGCGAGCGCCGGGATG
TCGTCGTTGATGGGCATGCTGCCGGTGAAGGCGGTCATCGCGACGACGGGCGAGGTTGTC
AGCGTGCGCGACGTCCGCGTGGGCGACGTCGTCGCGGTCAGGGCCGGCGAGATCGTCCCC
GTCGACGGCGTGGTGGTCGACGGCCAGAGCGAGGTCGACGAGAGGAGCCTCACCGGCGAG
TCCTTCCCGGTGCCGAAGCAGCCGCACTCCGAGGTCTGGGCCGGCACAATGAACTTTGAC
GGTTACATTGCTGTGAGAACTACGGCTCTCGCCGAGAACTCGACGGTGGCGAAGATGGAG
AGGCTGGTGGAGGCGGCGCAGAACAGCAGGTCGAAGACGCAGCGGCTGATCGATTCGTGC
GCAAAGTACTACACGCCGGCCGTGGTGGTTGTTGCAGCAGGAGTGGCCCTGATCCCGGCT
CTGCTCGGAGCAGATGGCCTTGAGCAATGGTGGAAGCTGGCTCTGGTGATGCTTGTGAGC
GCGTGCCCCTGCGCATTAGTGCTGTCGACACCGGTGGCATCCTTCTGCGCAATGCTGCGC
GCTGCGAGGATGGGGATCTTCATCAAGGGTGGAGATGTTCTTGAATCACTTGGGGAGATC
AGGGCCGTCGCGTTCGACAAGACCGGGACGATCACCAGAGGAGAGTTCAGCATCGACTCG
TTCCATCTGGTTGGGGATCACAAGGTTGAGATGGATCATCTTCTTTACTGGATTGCAAGC
ATTGAGAGCAAGTCAAGCCACCCAATGGCAGCTGCACTTGTGGAGTATGCTCAATCCAAA
TCCATCCAACCAAACCCGGAAAATGTGGGCGATTTTCGGATATATCCCGGGGAGGGGATC
TATGGAGAGATCCATGGAAAGCACATCTACATTGGGAACAGAAGGACATTGGCAAGAGCG
TCATCACCTCAGTCAACTCAAGAAATGGGTGAGATGATCAAGGGCGTGTCGATCGGCTAC
GTGATCTGCGACGGCGAGCTCGCCGGCGTCTTCTCGCTCTCCGACGACTGCCGGACCGGC
GCGGCGGAGGCGATCCGGGAGCTTGGATCGCTGGGCATCAAGTCGGTTATGCTGACCGGG
GACAGCAGCGCGGCGGCGACGCACGCGCAGGGCCAGCTCGGCGGCGTCATGGAGGAGCTC
CACTCCGAGCTCCTCCCGGAGGACAAGGTCCGGCTCGTCAGCGGCCTCAAGGCGAGGTTC
GGCCCGACGATGATGGTCGGGGACGGGATGAACGACGCGGCGGCGCTGGCGGCGGCGGAC
GTGGGCGTGTCCATGGGCATCTCCGGGTCGGCGGCGGCGATGGAGACCAGCCACGCGACG
CTCATGTCGAGCGACGTGCTCAGGGTCCCCGAGGCCGTCAGgctcggccggtgcgcccgc
cggaccatcgccgtcaacgtggccggctcggtggccgtgaaggccgccgtgctcgcgctg
gccgcggcgtggcgccccgtgctctgggccgccgtgctcgccgaCGTCGGGACGTGCCTC
CTCGTCGTGCTCAACAGCATGACGCTGCTCAGGGAGGAGTGGAAGGGCGGCGCCAAGGAG
GACGGCGCGTGCCGCGCCACGGCGAGGTCGCTGGTGATGAGGTCCCAGCTCGCCGCCGAC
TCCCAAGCACCCAACGCCGCAGACGCTGGCGCCGCCGGCCGTGAGCAAACGAACGGCTGC
CGTTGCTGTCCGAAGCCGGGCATGTCGCCCGAGCACTCGGTTGTCATCGACATCCGAGCC
GACGGCGAGCGTCAAGAAGAGCGGCCGGCCGAGGCGGCCGTCGTTGCCAAATGTTGCGGC
GGAGGCGGCGGCGAGGGCATCCGCTGCGGAGCCTCCAAGAAGCCAACTGCAACGGTCGTT
GTTGCCAAATGTTGCGGGGGCGGCGGCGGCGGCGAGGGCACCAGGTGCGGCGCGTCCAAG
AATCCGGCAACGGCGGCCGTCGTTGCCAAATGTTGCAGCGGAGGCGGCGGCGAGGGCATC
GGCTGCGGAGCCTCCAAGAAGCCAACTGCAACGGCCGTTGTTGCCAAATGTTGCGGCGGC
GGCGGCGAGGGCACCAGGTGCGCCGCGTCCAAGAAGCCGGCAACGGCGGCCGTCGTTGCC
AAATGTTGCGGTGGCGATGGCGGCGAGGGCACCGGATGTGGTGCCTCCAAGAGGTCGCCG
CCGGCTGAGGGAAGCTGCAGCGGCGGTGAAGGCGGTACCAATGGTGTTGGTCGTTGCTGC
ACGAGCGTGAAGAGGCCAACCTGTTGCGACATGGGAGCGGCGGAGGTGTCCGATTCTTCG
CCGGAGACGGCGAAAGACTGCAGAAATGGGAGGTGTTGCGCGAAGACGATGAACTCCGGT
GAAGTGAAAGGATGA

Protein

1005 aa

>Os07t0232900-01 Heavy metal-transporting P1B-ATPase, Root-to-shoot cadmium (Cd) translocation
MAGKDEAEGLEARLLLLPPEAAAEEPTRCGGGDGGGGGRKRKKTYLDVLGVCCSAEVALV
ERLLAPLDGVRVVSVVVASRTVVVEHDPAAAPESAIVKALNKAGLEASVRAYGSSGVVSR
WPSPYIVASGVLLTASFFEWLFPPLQCLAVAAVVAGAPPMVRRGFAAASRLSLDINVLML
IAVAGALCLGDYTEAGAIVFLFTTAEWLETLACTKASAGMSSLMGMLPVKAVIATTGEVV
SVRDVRVGDVVAVRAGEIVPVDGVVVDGQSEVDERSLTGESFPVPKQPHSEVWAGTMNFD
GYIAVRTTALAENSTVAKMERLVEAAQNSRSKTQRLIDSCAKYYTPAVVVVAAGVALIPA
LLGADGLEQWWKLALVMLVSACPCALVLSTPVASFCAMLRAARMGIFIKGGDVLESLGEI
RAVAFDKTGTITRGEFSIDSFHLVGDHKVEMDHLLYWIASIESKSSHPMAAALVEYAQSK
SIQPNPENVGDFRIYPGEGIYGEIHGKHIYIGNRRTLARASSPQSTQEMGEMIKGVSIGY
VICDGELAGVFSLSDDCRTGAAEAIRELGSLGIKSVMLTGDSSAAATHAQGQLGGVMEEL
HSELLPEDKVRLVSGLKARFGPTMMVGDGMNDAAALAAADVGVSMGISGSAAAMETSHAT
LMSSDVLRVPEAVRLGRCARRTIAVNVAGSVAVKAAVLALAAAWRPVLWAAVLADVGTCL
LVVLNSMTLLREEWKGGAKEDGACRATARSLVMRSQLAADSQAPNAADAGAAGREQTNGC
RCCPKPGMSPEHSVVIDIRADGERQEERPAEAAVVAKCCGGGGGEGIRCGASKKPTATVV
VAKCCGGGGGGEGTRCGASKNPATAAVVAKCCSGGGGEGIGCGASKKPTATAVVAKCCGG
GGEGTRCAASKKPATAAVVAKCCGGDGGEGTGCGASKRSPPAEGSCSGGEGGTNGVGRCC
TSVKRPTCCDMGAAEVSDSSPETAKDCRNGRCCAKTMNSGEVKG*

CDS

chr07:7409265..7409553 (- strand) : 289 bp

chr07:7408807..7409162 (- strand) : 356 bp

chr07:7408463..7408718 (- strand) : 256 bp

chr07:7408112..7408249 (- strand) : 138 bp

chr07:7407685..7408015 (- strand) : 331 bp

chr07:7407296..7407501 (- strand) : 206 bp

chr07:7405745..7407183 (- strand) : 1439 bp

FASTA

>Os07t0232900-01 class=Sequence position=chr07:7405745..7409553 (- strand)
ATGGCCGGAA AGGATGAGGC GGAAGGGCTC GAGGCGAGGC TGCTGCTGCT GCCGCCTGAG GCGGCGGCGG AGGAGCCGAC
GAGGTGTGGC GGCGGCGACG GCGGCGGCGG CGGGAGGAAG CGGAAGAAGA CGTACCTTGA TGTCCTTGGC GTGTGCTGCT
CCGCGGAGGT CGCGCTGGTG GAGCGGCTGC TCGCGCCGCT CGACGGCGTC CGCGTGGTGT CCGTCGTCGT GGCGTCCCGC
ACCGTCGTCG TCGAGCACGA CCCCGCCGCC GCCCCGGAGT CCGCCATCGG TAAGCCACCG CGCGCGCGCG CGCCATTAAT
CCTCCACGCG ATTCTCGCGC GAGATTCTCA CTGAATCGAG TCGTCGTCGT CGTCTTTGTC TTGGAGTGCA GTGAAGGCGC
TGAACAAGGC CGGCCTCGAG GCGTCGGTGC GAGCCTACGG CAGCAGCGGC GTGGTCAGCC GGTGGCCGAG CCCGTACATC
GTCGCCTCCG GCGTCCTCCT CACGGCGTCC TTCTTCGAGT GGCTCTTCCC TCCCCTGCAG Tgcctggccg tggcggccgt
cgtcgccggc gcgccgccga tggtgcgccg tgggttcgcc gcggcgagcc ggctgtcgct cgacatcaac gtcctcatgc
tcatcgccgt cgccggcgcg ctctgcctcg gcgactacac ggaggccggc gccatcgtct tcctcttcac cACCGCAGAA
TGGCTCGAGA CGCTGGCCTG CACAAAGGTA GGAGTACATG TCAATGTCCT CTTCACCAAA TCCATGGCGA TCTTGGCACG
AACCCGGACG AACACTCACG TTGCGAGGTG TGCAGGCGAG CGCCGGGATG TCGTCGTTGA TGGGCATGCT GCCGGTGAAG
GCGGTCATCG CGACGACGGG CGAGGTTGTC AGCGTGCGCG ACGTCCGCGT GGGCGACGTC GTCGCGGTCA GGGCCGGCGA
GATCGTCCCC GTCGACGGCG TGGTGGTCGA CGGCCAGAGC GAGGTCGACG AGAGGAGCCT CACCGGCGAG TCCTTCCCGG
TGCCGAAGCA GCCGCACTCC GAGGTCTGGG CCGGCACAAT GAACTTTGAC GGTAAACAAA CAAACAATCA AAAAAATCTC
TCATCTCTTA GTTTCAGAGT TCCCAAATGT ACGGAACTCT GAAACGTCCG TGTCGTtgaa ttgtccgtct tttctcatca
gcttaagttc tggtaaactg attgacgcat ccaactcaat agtCACAATA GCACACATTT GTTCATGTCA TGATCAATGG
GATTGAGAGG CTGTCACGTT TCAGGTTACA TTGCTGTGAG AACTACGGCT CTCGCCGAGA ACTCGACGGT GGCGAAGATG
GAGAGGCTGG TGGAGGCGGC GCAGAACAGC AGGTCGAAGA CGCAGCGGCT GATCGATTCG TGCGCAAAGT ACTACACGCC
GGGTGCGCAA TCGGCATCGC CTAAACTCTC AACATCTCCA ATTTTACAAC ACAAAATTCA TCAGTAACAA AGACATTTCT
GTTCTTGGTG CGTTGCAGCC GTGGTGGTTG TTGCAGCAGG AGTGGCCCTG ATCCCGGCTC TGCTCGGAGC AGATGGCCTT
GAGCAATGGT GGAAGCTGGC TCTGGTGATG CTTGTGAGCG CGTGCCCCTG CGCATTAGTG CTGTCGACAC CGGTGGCATC
CTTCTGCGCA ATGCTGCGCG CTGCGAGGAT GGGGATCTTC ATCAAGGGTG GAGATGTTCT TGAATCACTT GGGGAGATCA
GGGCCGTCGC GTTCGACAAG ACCGGGACGA TCACCAGAGG AGAGTTCAGC ATCGACTCGT TCCATCTGGT TGGGGATCAC
AAGGTTGAGA TGGATCATCT TCTTTACTGG TAAGACTGAG AAAGAAGATT TCATTTCAGC TCTTGGAATG CAGCTGCTAC
ACTGAACAAA TTTGACAGAT TTTCAACTGT TGTCGGTTTA CGACTTGTCG AAAAATCCTT AGTACTTGTG ATGGTTTGAA
TTGACTTGAA CAGTGAAATG CTTGGCACAA ATTATGTCTT TGGTTATTGC AGGATTGCAA GCATTGAGAG CAAGTCAAGC
CACCCAATGG CAGCTGCACT TGTGGAGTAT GCTCAATCCA AATCCATCCA ACCAAACCCG GAAAATGTGG GCGATTTTCG
GATATATCCC GGGGAGGGGA TCTATGGAGA GATCCATGGA AAGCACATCT ACATTGGGAA CAGAAGGACA TTGGCAAGAG
CGTCATCACC TCAGTCAAGT GAGCAAAACA CATCATTTGT AGTAGTAGTA CAGTTCCTGA CAATTAAGCT TCAGAATTAG
CTGATCAGCT GAAGCTGAGC TGACTGAACT GAAATCTGTG ACGTTTACAG CTCAAGAAAT GGGTGAGATG ATCAAGGGCG
TGTCGATCGG CTACGTGATC TGCGACGGCG AGCTCGCCGG CGTCTTCTCG CTCTCCGACG ACTGCCGGAC CGGCGCGGCG
GAGGCGATCC GGGAGCTTGG ATCGCTGGGC ATCAAGTCGG TTATGCTGAC CGGGGACAGC AGCGCGGCGG CGACGCACGC
GCAGGGCCAG CTCGGCGGCG TCATGGAGGA GCTCCACTCC GAGCTCCTCC CGGAGGACAA GGTCCGGCTC GTCAGCGGCC
TCAAGGCGAG GTTCGGCCCG ACGATGATGG TCGGGGACGG GATGAACGAC GCGGCGGCGC TGGCGGCGGC GGACGTGGGC
GTGTCCATGG GCATCTCCGG GTCGGCGGCG GCGATGGAGA CCAGCCACGC GACGCTCATG TCGAGCGACG TGCTCAGGGT
CCCCGAGGCC GTCAGgctcg gccggtgcgc ccgccggacc atcgccgtca acgtggccgg ctcggtggcc gtgaaggccg
ccgtgctcgc gctggccgcg gcgtggcgcc ccgtgctctg ggccgccgtg ctcgccgaCG TCGGGACGTG CCTCCTCGTC
GTGCTCAACA GCATGACGCT GCTCAGGGAG GAGTGGAAGG GCGGCGCCAA GGAGGACGGC GCGTGCCGCG CCACGGCGAG
GTCGCTGGTG ATGAGGTCCC AGCTCGCCGC CGACTCCCAA GCACCCAACG CCGCAGACGC TGGCGCCGCC GGCCGTGAGC
AAACGAACGG CTGCCGTTGC TGTCCGAAGC CGGGCATGTC GCCCGAGCAC TCGGTTGTCA TCGACATCCG AGCCGACGGC
GAGCGTCAAG AAGAGCGGCC GGCCGAGGCG GCCGTCGTTG CCAAATGTTG CGGCGGAGGC GGCGGCGAGG GCATCCGCTG
CGGAGCCTCC AAGAAGCCAA CTGCAACGGT CGTTGTTGCC AAATGTTGCG GGGGCGGCGG CGGCGGCGAG GGCACCAGGT
GCGGCGCGTC CAAGAATCCG GCAACGGCGG CCGTCGTTGC CAAATGTTGC AGCGGAGGCG GCGGCGAGGG CATCGGCTGC
GGAGCCTCCA AGAAGCCAAC TGCAACGGCC GTTGTTGCCA AATGTTGCGG CGGCGGCGGC GAGGGCACCA GGTGCGCCGC
GTCCAAGAAG CCGGCAACGG CGGCCGTCGT TGCCAAATGT TGCGGTGGCG ATGGCGGCGA GGGCACCGGA TGTGGTGCCT
CCAAGAGGTC GCCGCCGGCT GAGGGAAGCT GCAGCGGCGG TGAAGGCGGT ACCAATGGTG TTGGTCGTTG CTGCACGAGC
GTGAAGAGGC CAACCTGTTG CGACATGGGA GCGGCGGAGG TGTCCGATTC TTCGCCGGAG ACGGCGAAAG ACTGCAGAAA
TGGGAGGTGT TGCGCGAAGA CGATGAACTC CGGTGAAGTG AAAGGATGA