Os07t0235800-01

Locus

Os07g0235800

Description

AP2 domain containing transcription factor, Control of inflorescence architecture, Floral meristem establishment, Regulation of grain size

RAP-DB Gene Symbol Synonym(s)

SNB, AP2/EREBP73, OsSNB

RAP-DB Gene Name Synonym(s)

SUPERNUMERARY BRACT, APETALA2/ethylene-responsive element binding protein 73

CGSNL Gene Symbol

SNB

CGSNL Gene Name

SUPERNUMERARY BRACT GENE

Oryzabase Gene Symbol Synonym(s)

AP2/EREBP#073, AP2/EREBP73, AP2-3, SSH1, OsSSH1, OsSNB, DLN181, DLN181a, DLN181b, OsDLN181, OsDLN181a, OsDLN181b, SUI4, OsSUI4, SUI4/SNB

Oryzabase Gene Name Synonym(s)

Supernumerary Bract gene, Supernumerary Bract, SUPERNUMERARY BRACT, supernumerary bract, transcription factor; SNB, APETALA2/ethylene-responsive element binding protein 73, APETALA2-3, suppression of shattering1, DLN repressor 181, DLN motif protein 181, shortened uppermost internode 4

Transcript Evidence

DQ374663 (Dongjin)

AK111874

Protein Evidence

Q8H443

Literature

PMID: 31150378

PMID: 22003982

PMID: 17144896

Note

Manual Curation

July 29, 2019

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Functional domain (InterPro)

DNA-binding domain (IPR016177)

AP2/ERF domain (IPR001471)

Expression Databases

TENOR (Os07t0235800-01)

Others

Oryzabase (6443)

Transcript

2000 bp

>Os07t0235800-01 AP2 domain containing transcription factor, Control of inflorescence architecture, Floral meristem establishment, Regulation of grain size
ACGTCCCATCCATCCCTCCCCCCCCTTTTCCCTCCTCCTCCACCTCCACTGCCATGGCCG
CCTCCGCCGCTCCTCTCTCCCGCGTGGTAGCCGCCGCCGGTTGCCGCCGCTAGGGGAGCG
CGACGGGGGAACGGTAGGGGCGACCCAGCTCGCTCTGTCGCCCCGCGGCTGGTGGGGGTG
CGCGCGGGGGAGAGCGGTTGGTTAGTATGGTGCTGGATCTCAATGTGGAGTCGCCGGGTG
GGTCGGCGGCGACGTCGAGCTCGTCCACGCCGCCGCCGCCGCCCGACGGTGGCGGCGGGG
GGTACTTCCGGTTCGACCTGCTCGGCGGGAGCCCCGACGAGGACGGGTGCTCCTCGCCTG
TCATGACGCGCCAGCTCTTCCCTTCGCCGTCTGCGGTGGTGGCGCTGGCGGGGGACGGGT
CGTCGACGCCACCGCTGACGATGCCGATGCCGGCGGCGGCTGGGGAGGGGCCGTGGCCGC
GCCGCGCGGCGGATCTCGGGGTGGCGCAGAGCCAGAGGTCCCCCGCCGGCGGGAAGAAGA
GCCGCCGCGGCCCGAGGTCTCGGAGCTCCCAGTACAGGGGCGTCACCTTCTACAGGAGGA
CCGGGCGATGGGAGTCGCACATCTGGGACTGCGGGAAGCAGGTGTACCTGGGTGGTTTCG
ATACAGCTCATGCCGCAGCGAGGGCCTATGATCGCGCGGCGATCAAGTTCAGAGGCCTCG
ACGCGGATATCAACTTTAATCTGAATGACTATGAGGACGACTTGAAGCAGATGCGCAATT
GGACCAAGGAGGAGTTTGTGCACATACTTCGGCGCCAAAGCACAGGATTTGCAAGGGGGA
GCTCAAAGTACCGGGGTGTGACACTGCACAAGTGTGGCCGGTGGGAAGCTCGGATGGGCC
AGCTGCTCGGCAAGAAGTACATCTATCTAGGATTGTTTGACAGTGAAATTGAGGCTGCAA
GAGCATATGACCGGGCAGCTATCCGCTTCAATGGAAGGGAAGCTGTTACTAATTTTGATC
CTAGTTCTTATGATGGAGATGTTCTACCTGAAACCGACAATGAAGTGGTTGATGGAGACA
TCATTGACTTAAATCTGAGAATTTCACAGCCTAACGTTCATGAGCTGAAAAGTGATGGTA
CCCTAACTGGGTTCCAGTTGAATTGTGATTCTCCTGAAGCTTCAAGTTCTGTTGTTACTC
AGCCAATAAGTCCTCAGTGGCCTGTGCTTCCTCAGGGCACATCGATGTCCCAGCATCCAC
ATTTATATGCATCTCCTTGTCCGGGCTTCTTTGTGAACCTCAGGGAAGTACCTATGGAGA
AAAGACCTGAGTTGGGTCCCCAGTCGTTCCCTACTTCGTGGTCATGGCAAATGCAGGGCT
CCCCTTTGCCATTACTCCCTACTGCAGCATCATCAGGATTCTCTACGGGCACCGTCGCCG
ACGCCGCCCGCTCGCCTTCCTCCCGCCCCCATCCATTTCCCGGCCACCACCAGTTCTACT
TCCCCCCGACCGCCTGACTGCCACCTATTCTGGTGGAGGCGACACCTCACCGTGCATCCA
CCGCCGCTTGCTGATAACATTCGTCGTTTGTCCAGAGAGGGACCTTCTCCATATGATATC
CCTCTCTATGTTCCACCTGGTTATGATCAGAATTCTCACGCTCATGATTCTTTTATCTTC
ATTTTTGAGTGCGAAACCACGAATCGTGACCGTGCTACCAGGTAAACACCCTTGTACCTC
TTTGACTCTACAATAAAATTAATGTAAGATATTCTGGCTAAAAGTGATTGGCCCTCCCTA
CTGTATTTTTACAGAGTTGTAATTTGAACAGTGGGCACTAAAGCTGGGGCCCACTCGCAC
CAGTGTCTAGTGGAGCGAAGCTTTGCCCTTTTCTTGCTATCCAGCAACTATTCCTCCGCC
TGCCTCCATTGCTGACAGTGGAGATAGCTTCCCAGTGGTCACTGTTCCACTGTACTCTGT
CATAGTTTCTGATCACCCCT

CDS

1311 bp

>Os07t0235800-01 AP2 domain containing transcription factor, Control of inflorescence architecture, Floral meristem establishment, Regulation of grain size
ATGGTGCTGGATCTCAATGTGGAGTCGCCGGGTGGGTCGGCGGCGACGTCGAGCTCGTCC
ACGCCGCCGCCGCCGCCCGACGGTGGCGGCGGGGGGTACTTCCGGTTCGACCTGCTCGGC
GGGAGCCCCGACGAGGACGGGTGCTCCTCGCCTGTCATGACGCGCCAGCTCTTCCCTTCG
CCGTCTGCGGTGGTGGCGCTGGCGGGGGACGGGTCGTCGACGCCACCGCTGACGATGCCG
ATGCCGGCGGCGGCTGGGGAGGGGCCGTGGCCGCGCCGCGCGGCGGATCTCGGGGTGGCG
CAGAGCCAGAGGTCCCCCGCCGGCGGGAAGAAGAGCCGCCGCGGCCCGAGGTCTCGGAGC
TCCCAGTACAGGGGCGTCACCTTCTACAGGAGGACCGGGCGATGGGAGTCGCACATCTGG
GACTGCGGGAAGCAGGTGTACCTGGGTGGTTTCGATACAGCTCATGCCGCAGCGAGGGCC
TATGATCGCGCGGCGATCAAGTTCAGAGGCCTCGACGCGGATATCAACTTTAATCTGAAT
GACTATGAGGACGACTTGAAGCAGATGCGCAATTGGACCAAGGAGGAGTTTGTGCACATA
CTTCGGCGCCAAAGCACAGGATTTGCAAGGGGGAGCTCAAAGTACCGGGGTGTGACACTG
CACAAGTGTGGCCGGTGGGAAGCTCGGATGGGCCAGCTGCTCGGCAAGAAGTACATCTAT
CTAGGATTGTTTGACAGTGAAATTGAGGCTGCAAGAGCATATGACCGGGCAGCTATCCGC
TTCAATGGAAGGGAAGCTGTTACTAATTTTGATCCTAGTTCTTATGATGGAGATGTTCTA
CCTGAAACCGACAATGAAGTGGTTGATGGAGACATCATTGACTTAAATCTGAGAATTTCA
CAGCCTAACGTTCATGAGCTGAAAAGTGATGGTACCCTAACTGGGTTCCAGTTGAATTGT
GATTCTCCTGAAGCTTCAAGTTCTGTTGTTACTCAGCCAATAAGTCCTCAGTGGCCTGTG
CTTCCTCAGGGCACATCGATGTCCCAGCATCCACATTTATATGCATCTCCTTGTCCGGGC
TTCTTTGTGAACCTCAGGGAAGTACCTATGGAGAAAAGACCTGAGTTGGGTCCCCAGTCG
TTCCCTACTTCGTGGTCATGGCAAATGCAGGGCTCCCCTTTGCCATTACTCCCTACTGCA
GCATCATCAGGATTCTCTACGGGCACCGTCGCCGACGCCGCCCGCTCGCCTTCCTCCCGC
CCCCATCCATTTCCCGGCCACCACCAGTTCTACTTCCCCCCGACCGCCTGA

Protein

437 aa

>Os07t0235800-01 AP2 domain containing transcription factor, Control of inflorescence architecture, Floral meristem establishment, Regulation of grain size
MVLDLNVESPGGSAATSSSSTPPPPPDGGGGGYFRFDLLGGSPDEDGCSSPVMTRQLFPS
PSAVVALAGDGSSTPPLTMPMPAAAGEGPWPRRAADLGVAQSQRSPAGGKKSRRGPRSRS
SQYRGVTFYRRTGRWESHIWDCGKQVYLGGFDTAHAAARAYDRAAIKFRGLDADINFNLN
DYEDDLKQMRNWTKEEFVHILRRQSTGFARGSSKYRGVTLHKCGRWEARMGQLLGKKYIY
LGLFDSEIEAARAYDRAAIRFNGREAVTNFDPSSYDGDVLPETDNEVVDGDIIDLNLRIS
QPNVHELKSDGTLTGFQLNCDSPEASSSVVTQPISPQWPVLPQGTSMSQHPHLYASPCPG
FFVNLREVPMEKRPELGPQSFPTSWSWQMQGSPLPLLPTAASSGFSTGTVADAARSPSSR
PHPFPGHHQFYFPPTA*

5'UTR

chr07:7545547..7545752 (+ strand) : 206 bp

CDS

chr07:7545753..7546171 (+ strand) : 419 bp

chr07:7546274..7546299 (+ strand) : 26 bp

chr07:7546420..7546450 (+ strand) : 31 bp

chr07:7546534..7546621 (+ strand) : 88 bp

chr07:7546733..7546878 (+ strand) : 146 bp

chr07:7547485..7547529 (+ strand) : 45 bp

chr07:7547620..7547723 (+ strand) : 104 bp

chr07:7547820..7547956 (+ strand) : 137 bp

chr07:7548397..7548498 (+ strand) : 102 bp

chr07:7549219..7549431 (+ strand) : 213 bp

3'UTR

chr07:7549432..7549914 (+ strand) : 483 bp

FASTA

>Os07t0235800-01 class=Sequence position=chr07:7545547..7549914 (+ strand)
ACGTCCCATC CATCCCTCCC CCCCCTTTTC CCTCCTCCTC CACCTCCACT GCCATGGCCG CCTCCGCCGC TCCTCTCTCC
CGCGTGGTAG CCGCCGCCGG TTGCCGCCGC TAGGGGAGCG CGACGGGGGA ACGGTAGGGG CGACCCAGCT CGCTCTGTCG
CCCCGCGGCT GGTGGGGGTG CGCGCGGGGG AGAGCGGTTG GTTAGTATGG TGCTGGATCT CAATGTGGAG TCGCCGGGTG
GGTCGGCGGC GACGTCGAGC TCGTCCACGC CGCCGCCGCC GCCCGACGGT GGCGGCGGGG GGTACTTCCG GTTCGACCTG
CTCGGCGGGA GCCCCGACGA GGACGGGTGC TCCTCGCCTG TCATGACGCG CCAGCTCTTC CCTTCGCCGT CTGCGGTGGT
GGCGCTGGCG GGGGACGGGT CGTCGACGCC ACCGCTGACG ATGCCGATGC CGGCGGCGGC TGGGGAGGGG CCGTGGCCGC
GCCGCGCGGC GGATCTCGGG GTGGCGCAGA GCCAGAGGTC CCCCGCCGGC GGGAAGAAGA GCCGCCGCGG CCCGAGGTCT
CGGAGCTCCC AGTACAGGGG CGTCACCTTC TACAGGAGGA CCGGGCGATG GGAGTCGCAC ATCTGGTTAG CTTCGCCTTG
CTCGATTTCC CTCACGCTGA CTTCCTCTGC TTGACTCTGC TTGATTGGAG TAGTAATCTC TTCGTTTGTC TCGTCCAATT
TTGGCAGGGA CTGCGGGAAG CAGGTGTACC TGGGTGAGCT CCTATTTCTA GTCTCCCAAG CTAAATTCGC TCGCATGACT
GCTAAATTTG GGTCTCTACT TAGCTTGATT CCGATTTGTT TGCTCCTGCC TTGTTTTTTT TTTCTGTTTT CAGGTGGTTT
CGATACAGCT CATGCCGCAG CGAGGTTACT ATAAATGGTC ACCAATTGTA TCTTAATTGT TGCTCTGGTT TGCCCTGTGT
GCTGAGATTG TAGAACCCCT TGTGCAGGGC CTATGATCGC GCGGCGATCA AGTTCAGAGG CCTCGACGCG GATATCAACT
TTAATCTGAA TGACTATGAG GACGACTTGA AGCAGGTTGT TTGGAATATA GTTCAATTGT CATGTGTGAT TCTTTAGGTT
CTAAGGGGAG GTTCATTCAC CGGCCTGTGA TGGTTTATGA TGGATTGGTT CGTGCTGTGT TGTTAGATGC GCAATTGGAC
CAAGGAGGAG TTTGTGCACA TACTTCGGCG CCAAAGCACA GGATTTGCAA GGGGGAGCTC AAAGTACCGG GGTGTGACAC
TGCACAAGTG TGGCCGGTGG GAAGCTCGGA TGGGCCAGCT GCTCGGCAAG AAGTAAGATC CCTGAAACAT TGATTGTTCT
TGCTAGTAAC TTACAATACA ATACATTTTA GATTAGTTCA GGACCATTTT TCATGCCATG AACGAAAACT GTGTCAAGTT
TGCTTTTCAA AAAGGGAAAG AAAAAAAATG TGTCACTACC AAGCTGGAGA ATGGTAGGCT ACCCCTGGAG TCCACATCCA
CCTGAAGATT TGATGTTGAC TCTTCACACA CTAGCCATTT ACTATTGGAA CACCACAGGT GTTCAATGAT TATAGATTGC
TAGCTTCTTT AGGAAAGAAC TAAGTGAATC GGAATGGCTC CTCGGAATTA ATTGAGGGGA AATGTTTTTG TTTCCTTGGG
GATTGTGTTT TGCATCCTAA GTCAGTGATA GGTGAAAAGC TTCATTTCAA TGCTCTTGGT TGTTTTTGCC ACTAAGAATG
TTCTGCTTAT TTACGTTGAA TTTTTGATTG GCTGTTCGTA TCATAGTTGT GCATTTCCTA TATATTACAA TCTTTGTGAA
CTTTAGATAA TTCTGGCATG AGCTCTCTCT GTGGTATTGT TCTATTAACA GAAGTATCAT TCTGTCAATT CCCCACTGAT
AAGTGATCTT TTGTGCAGGT ACATCTATCT AGGATTGTTT GACAGTGAAA TTGAGGCTGC AAGGTTCAGT TAGTAGTACT
TTGCTCTTCT CAGTTTGATA TGTGCTTGCT ATTCCTATAC TTCTCTCACT TTCATCTACT CTTCAACTTG TAGAGCATAT
GACCGGGCAG CTATCCGCTT CAATGGAAGG GAAGCTGTTA CTAATTTTGA TCCTAGTTCT TATGATGGAG ATGTTCTACC
TGAAACCGAC AATGAAGGTA TTTCTTTTGT ACTATGTATA TTGTGCTTTA TCCACTAGAA CGACAAATCC AAATTTTATA
TTAACAAAAG CACACTGGGG ATTGTCTTAG CAGTGGTTGA TGGAGACATC ATTGACTTAA ATCTGAGAAT TTCACAGCCT
AACGTTCATG AGCTGAAAAG TGATGGTACC CTAACTGGGT TCCAGTTGAA TTGTGATTCT CCTGAAGCTT CAAGTTCTGT
TGTTACTCAG GTAAATATGC TACAATATTT GGTGTTTGTA ACCGCTATAC CATTTGAGAT TTGACCGTCT TCAGATTCTT
TTGATCAGGT GGTTAGTCCT TTTTCATAAC ATTATACTAT CACTTTCAAA ATAATTAGTA CACTAATTGT ATGTGTCACT
AGAATTGTTG TATGAAACCA TCTGGGAACC ATCTTATGCA GCTTATTGAC AAATGACAAC TCACTGTTGA TGTATTCCCA
AATCAAGAAA AGCCAATCTT TTTATTCAAT TTCTCCAGTT CATTGAATTG AAAAAGAAAT TGCCGAACAA CTACCACCTG
AAGAGACTGG CTAGATATTT TGTTTATCTG TGTATTTTTA TAACCTATAA CAGTTCCAAA GCCACAAAGC TCTTTTACCT
TGATTCTGAT AACGTTAACT GAGGTATCAT TTTGTGATTG TTTTCTGTAG CCAATAAGTC CTCAGTGGCC TGTGCTTCCT
CAGGGCACAT CGATGTCCCA GCATCCACAT TTATATGCAT CTCCTTGTCC GGGCTTCTTT GTGAACCTCA GGGTATATCT
ATCATCAAAA CTTATATGCA ATTTGAAAAG ACAGTTAAAC TTGTTTCAAG TTAACATTCG ATTGCTAATT AGCTACTACT
TCCATGCTCC TATTTCTTGA GATGACGAAC CATATGTTTG TTCCTTTAAT TACATAATGG TAGCCGTAGA TACTGTTTGC
CTTGTGAACT GTCAGATATA GCAGGAAGTA AATCTGTCAG CTTGCAACTT TCCATGAACC ACAGCTGTCC AACTTTATAC
AGTGGATGAT GACTTGCATT TGATACATCC TAGTACTTTC TTGTTGCACT CTGCAGCTTT AGCTCTGAAG ATGCTCTATA
TTTCCATGAA TGCTCACGTT AGCTCTGAAA TTTCGAACTT TCACTCCATA ACATGCTCAC TTAGGCTGTG tttagatcca
aacttcagtt cttttccatc acatcaacct gtcatacaca cacaactttt cagtcacatc atctctaatt tcaaccaaaa
tccaaacttt gccatcaact aaacacagcc TTATTCATTG TTCCACCTTT TATTTCTGCC ATTGCTAAGG TCCAATCTTG
ATACCTCAGA GAGCTGCATG ATGTGTAGAT AGTCCTAACT TAGGTCCGTT GGTTAGAATC ATCCATTCAT GTTTAGGAAA
AGTGATTAAC AACGTGTGCT GCATTAACCA TTAATGTGGT CAACTCTGAT GCTTGTGCTA TGGTCACTGC AGGAAGTACC
TATGGAGAAA AGACCTGAGT TGGGTCCCCA GTCGTTCCCT ACTTCGTGGT CATGGCAAAT GCAGGGCTCC CCTTTGCCAT
TACTCCCTAC TGCAGCATCA TCAGGATTCT CTACGGGCAC CGTCGCCGAC GCCGCCCGCT CGCCTTCCTC CCGCCCCCAT
CCATTTCCCG GCCACCACCA GTTCTACTTC CCCCCGACCG CCTGACTGCC ACCTATTCTG GTGGAGGCGA CACCTCACCG
TGCATCCACC GCCGCTTGCT GATAACATTC GTCGTTTGTC CAGAGAGGGA CCTTCTCCAT ATGATATCCC TCTCTATGTT
CCACCTGGTT ATGATCAGAA TTCTCACGCT CATGATTCTT TTATCTTCAT TTTTGAGTGC GAAACCACGA ATCGTGACCG
TGCTACCAGG TAAACACCCT TGTACCTCTT TGACTCTACA ATAAAATTAA TGTAAGATAT TCTGGCTAAA AGTGATTGGC
CCTCCCTACT GTATTTTTAC AGAGTTGTAA TTTGAACAGT GGGCACTAAA GCTGGGGCCC ACTCGCACCA GTGTCTAGTG
GAGCGAAGCT TTGCCCTTTT CTTGCTATCC AGCAACTATT CCTCCGCCTG CCTCCATTGC TGACAGTGGA GATAGCTTCC
CAGTGGTCAC TGTTCCACTG TACTCTGTCA TAGTTTCTGA TCACCCCT