Os07t0258400-01

Locus

Os07g0258400

Description

OsNramp1 (Integral membrane protein).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NRAMP1

CGSNL Gene Name

BACTERIOCIDE EFFECT 1

Oryzabase Gene Symbol Synonym(s)

OsNramp1, OsNRAMP1, OsNramp6

Oryzabase Gene Name Synonym(s)

homologues of mammalian Nramp1 gene

Transcript Evidence

AK121534 (DDBJ, Best hit)

Protein Evidence

Q0D7E4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transport (GO:0006810)

Cellular Component: membrane (GO:0016020)

Molecular Function: transporter activity (GO:0005215)

Functional domain (InterPro)

Natural resistance-associated macrophage protein (IPR001046)

Full-length cDNA

J033031A07 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0258400-01)

RiceXPro (AK121534)

Others

Oryzabase (6243)

KEGG (Os07t0258400-01)

Transcript

2082 bp

>Os07t0258400-01 OsNramp1 (Integral membrane protein).
GCAGAGATCGGGGTTCGGCGCCGGCGGCGAGTTGTTGAGAGGCAAGGCAAACTCAGGCGA
CTGAGCTAAAGAAGCCGCACTAGTATGGGGGTGACGAAGGCGGAGGCGGTTGCCGGCGAC
GGCGGGAAGGTGGTGGACGACATCGAGGCGCTCGCCGATCTCAGAAAGGAGCCAGCATGG
AAAAGGTTTTTGTCCCACATTGGACCAGGCTTTATGGTCTGTTTGGCTTACCTCGATCCT
GGAAATATGGAGACTGATCTACAAGCTGGTGCCAATCACAAATATGAGCTTCTTTGGGTG
ATTTTGATTGGCCTGATCTTTGCACTGATTATACAATCATTATCGGCTAATCTTGGAGTG
GTGACAGGGCGCCATCTTGCTGAGCTGTGCAAGACTGAATATCCAGTATGGGTGAAAACC
TGCTTATGGCTGCTAGCAGAACTAGCTGTGATTGCTTCCGATATTCCAGAAGTTATAGGT
ACAGGATTTGCTTTCAACCTTTTGTTCCACATACCAGTGTGGACCGGGGTTCTCATTGCT
GGCTCTAGCACGCTTCTTCTTCTTGGACTGCAAAGATATGGGGTAAGGAAACTGGAGGTT
GTGGTCGCGCTATTGGTGTTTGTCATGGCAGGGTGCTTCTTCGTGGAGATGAGCATAGTC
AAGCCTCCGGTTAATGAGGTCCTTCAAGGATTATTCATCCCCAGGCTCAGTGGGCCCGGT
GCCACAGGAGACTCCATTGCCCTTCTTGGGGCTCTTGTAATGCCGCACAATCTATTCTTG
CACTCTGCCCTGGTGCTGTCGAGGAATACACCCGCATCAGCAAAAGGAATGAAGGATGTC
TGTAGGTTCTTCCTCTTTGAGAGTGGGATAGCTCTTTTCGTGGCTCTGCTTGTCAACATT
GCAATCATCTCTGTCTCCGGCACTGTATGTAATGCAACCAACCTTTCACCAGAAGATGCT
GTAAAATGCAGCGACCTTACATTGGACTCCTCATCCTTCCTCCTCAGGAATGTGCTAGGA
AAGTCAAGTGCGACAGTGTACGGTGTAGCACTCTTGGCTTCTGGACAGAGCTCGACCATT
ACTGGCACTTATGCTGGGCAATATGTTATGCAGGGGTTCCTAGACATCAAAATGAAACAG
TGGCTTCGGAACCTGATGACACGCAGCATTGCCATTGTGCCTAGCTTAATCGTCTCCATC
ATTGGAGGGTCTAGTGGCGCCGGTCGTCTCATCGTCATTGCATCGATGATTCTATCCTTT
GAGCTACCATTTGCTCTGATCCCTCTTCTCAAGTTCAGCAGCAGCAGCAACAAGATGGGT
GAAAACAAGAACTCCATCTATATTGTTGGATTCTCCTGGGTGCTGGGGTTCGTCATCATC
GGGATAAACATCTACTTCCTCAGCACAAAGCTGGTCGGCTGGATCCTCCACAACGCGCTC
CCGACATTCGCCAACGTGCTCATCGGCATCGTGCTGTTCCCGCTCATGCTGCTCTACGTC
GTCGCCGTGATCTACCTGACGTTCAGGAAGGACACCGTCAAGTTCGTGTCTCGTCGTGAG
CTGCAGGCCGGCGACGACACCGAGAAAGCACAGGTAGCCACCTGCGTCGCCGACGAGCAC
AGCAAAGAGCCACCCGTGTAGTACCCTTCCAGACCGGTTACCGGTGTTGGCTGGTTTTTA
TTGGATAGATGTTTAGGTCCAATTTTTTTTATATAAAAAATCCAATAGATGTTTAGGTCC
AAATTTTTGAATTCAAAAACCGGTTAGCAGTGATAACCGGCTGAAATTTTGGCCCATGGG
AGTAGATTGTTGCTTTTTTTCTTAGTGATTAGTTATTGGCAGATTGGCAGAATGTTGTAG
CTAGGCAATCTAATTGTATGGTTAGATATTTAGTCATAAATCCAAGAGTGAGTTTTCTTG
GATGCGAGGACAAGGACAATCTAATTGTATGGTTAGATATTTAGTCATAAATCCAAGAGT
GAGTTTTCTTGGATGCGAGGACAAGGACAAATATAAATGTAAATAAATGCAGTTAAAGTA
ACACCTTGCTCAAATATAAATGTAAATAAATGCAGTTAAAGT

CDS

1557 bp

>Os07t0258400-01 OsNramp1 (Integral membrane protein).
ATGGGGGTGACGAAGGCGGAGGCGGTTGCCGGCGACGGCGGGAAGGTGGTGGACGACATC
GAGGCGCTCGCCGATCTCAGAAAGGAGCCAGCATGGAAAAGGTTTTTGTCCCACATTGGA
CCAGGCTTTATGGTCTGTTTGGCTTACCTCGATCCTGGAAATATGGAGACTGATCTACAA
GCTGGTGCCAATCACAAATATGAGCTTCTTTGGGTGATTTTGATTGGCCTGATCTTTGCA
CTGATTATACAATCATTATCGGCTAATCTTGGAGTGGTGACAGGGCGCCATCTTGCTGAG
CTGTGCAAGACTGAATATCCAGTATGGGTGAAAACCTGCTTATGGCTGCTAGCAGAACTA
GCTGTGATTGCTTCCGATATTCCAGAAGTTATAGGTACAGGATTTGCTTTCAACCTTTTG
TTCCACATACCAGTGTGGACCGGGGTTCTCATTGCTGGCTCTAGCACGCTTCTTCTTCTT
GGACTGCAAAGATATGGGGTAAGGAAACTGGAGGTTGTGGTCGCGCTATTGGTGTTTGTC
ATGGCAGGGTGCTTCTTCGTGGAGATGAGCATAGTCAAGCCTCCGGTTAATGAGGTCCTT
CAAGGATTATTCATCCCCAGGCTCAGTGGGCCCGGTGCCACAGGAGACTCCATTGCCCTT
CTTGGGGCTCTTGTAATGCCGCACAATCTATTCTTGCACTCTGCCCTGGTGCTGTCGAGG
AATACACCCGCATCAGCAAAAGGAATGAAGGATGTCTGTAGGTTCTTCCTCTTTGAGAGT
GGGATAGCTCTTTTCGTGGCTCTGCTTGTCAACATTGCAATCATCTCTGTCTCCGGCACT
GTATGTAATGCAACCAACCTTTCACCAGAAGATGCTGTAAAATGCAGCGACCTTACATTG
GACTCCTCATCCTTCCTCCTCAGGAATGTGCTAGGAAAGTCAAGTGCGACAGTGTACGGT
GTAGCACTCTTGGCTTCTGGACAGAGCTCGACCATTACTGGCACTTATGCTGGGCAATAT
GTTATGCAGGGGTTCCTAGACATCAAAATGAAACAGTGGCTTCGGAACCTGATGACACGC
AGCATTGCCATTGTGCCTAGCTTAATCGTCTCCATCATTGGAGGGTCTAGTGGCGCCGGT
CGTCTCATCGTCATTGCATCGATGATTCTATCCTTTGAGCTACCATTTGCTCTGATCCCT
CTTCTCAAGTTCAGCAGCAGCAGCAACAAGATGGGTGAAAACAAGAACTCCATCTATATT
GTTGGATTCTCCTGGGTGCTGGGGTTCGTCATCATCGGGATAAACATCTACTTCCTCAGC
ACAAAGCTGGTCGGCTGGATCCTCCACAACGCGCTCCCGACATTCGCCAACGTGCTCATC
GGCATCGTGCTGTTCCCGCTCATGCTGCTCTACGTCGTCGCCGTGATCTACCTGACGTTC
AGGAAGGACACCGTCAAGTTCGTGTCTCGTCGTGAGCTGCAGGCCGGCGACGACACCGAG
AAAGCACAGGTAGCCACCTGCGTCGCCGACGAGCACAGCAAAGAGCCACCCGTGTAG

Protein

519 aa

>Os07t0258400-01 OsNramp1 (Integral membrane protein).
MGVTKAEAVAGDGGKVVDDIEALADLRKEPAWKRFLSHIGPGFMVCLAYLDPGNMETDLQ
AGANHKYELLWVILIGLIFALIIQSLSANLGVVTGRHLAELCKTEYPVWVKTCLWLLAEL
AVIASDIPEVIGTGFAFNLLFHIPVWTGVLIAGSSTLLLLGLQRYGVRKLEVVVALLVFV
MAGCFFVEMSIVKPPVNEVLQGLFIPRLSGPGATGDSIALLGALVMPHNLFLHSALVLSR
NTPASAKGMKDVCRFFLFESGIALFVALLVNIAIISVSGTVCNATNLSPEDAVKCSDLTL
DSSSFLLRNVLGKSSATVYGVALLASGQSSTITGTYAGQYVMQGFLDIKMKQWLRNLMTR
SIAIVPSLIVSIIGGSSGAGRLIVIASMILSFELPFALIPLLKFSSSSNKMGENKNSIYI
VGFSWVLGFVIIGINIYFLSTKLVGWILHNALPTFANVLIGIVLFPLMLLYVVAVIYLTF
RKDTVKFVSRRELQAGDDTEKAQVATCVADEHSKEPPV*

5'UTR

chr07:8966025..8966108 (+ strand) : 84 bp

CDS

chr07:8966109..8966192 (+ strand) : 84 bp

chr07:8967237..8967315 (+ strand) : 79 bp

chr07:8967385..8967425 (+ strand) : 41 bp

chr07:8967557..8967635 (+ strand) : 79 bp

chr07:8967717..8967821 (+ strand) : 105 bp

chr07:8968062..8968171 (+ strand) : 110 bp

chr07:8968353..8968534 (+ strand) : 182 bp

chr07:8968752..8968821 (+ strand) : 70 bp

chr07:8968909..8969082 (+ strand) : 174 bp

chr07:8969216..8969320 (+ strand) : 105 bp

chr07:8969527..8969658 (+ strand) : 132 bp

chr07:8969905..8970000 (+ strand) : 96 bp

chr07:8970116..8970415 (+ strand) : 300 bp

3'UTR

chr07:8970416..8970856 (+ strand) : 441 bp

FASTA

>Os07t0258400-01 class=Sequence position=chr07:8966025..8970856 (+ strand)
GCAGAGATCG GGGTTCGGCG CCGGCGGCGA GTTGTTGAGA GGCAAGGCAA ACTCAGGCGA CTGAGCTAAA GAAGCCGCAC
TAGTATGGGG GTGACGAAGG CGGAGGCGGT TGCCGGCGAC GGCGGGAAGG TGGTGGACGA CATCGAGGCG CTCGCCGATC
TCAGAAAGGT TAATTCTCTC TGCAAATACT CCTGGTTGCT CATACTTAAA TCTACCTATG AATGAGGGAT CGCATCGATG
TCGCAGTTGG AGTTGGACGG ACAGGAGTGA GAAATTATTA TCTCTGATCT GATTCCTGTT GGTATGCACT CTTGCTGTTT
GTGAAAATGC CCCAGAGGAT GCATCCACAG GACACGGCGC CTTCAATATT TATAAGTTGA TTCAATGATG GGTTTCTTTC
ATGTTTCTTT GCTGAAAAAT CGTGTTTAGT AGAGTAGTCT TCTATGTCTC TATTCAAAAG AAAAGTGGCA TTAAGTTATA
GGAGAAAATA AAAGGGAGAA GTCGTTTTGT TAATTAGGAG CTTCTCCTTT CGATAACTAT GACTTAATAG TTCATTTTTA
TTATGGAACA AAGATGAGAT ACAAAACAAT AGATTGTGAT CACCTCAGTT TTTTTGTTTG ATATCAAGTC TGACAAACTA
AGGCATTACG GTTCTCTGCT CTTGTTTGAC AAACGAAGTC TATTGTACAA TAGAAGTCTG TTGTTTAATG TCTCTACTTT
TGGTCATCTC TTGTATGGTT TAGCCTAGAT CTCAGTTTAT CTTACTATAG GTCGCCGATA GTACAATATG ATTTGTTTCT
CCGCCGTACC TAATCCAAAA TCATATAGCT TGACATTATC TGCTTCGCAT AGATGTTCGT TATAAGCTTC AAATTACAAA
TTTCATATTG AAAGTTTAGC CTCTTCTTGT TGGACTATAA TAGCGAGTCC ATGTGAACAT CATTTCTTAC ATTAATATAC
ATTTCTTCAC ATTTGTGGCT AGTTATTTTA CTTGCCCTAC CATTGTCGCA TTTATTTATA TTTCCATAAC TCATTTTCCA
ATGCTTAGTT GAATGTATCA TTCACTCATT CTTGTATTGT TTGTACGTCT TTGAGACTTT GACTGAAAAT AGTCTTAGTT
TTGTACCTAT TTTATATTTT GCTTTATGTT TTAATTATTT TCTTTGACAT GATGTGCATG CATATTTATT ACTAATTGGT
CATGTAACAC AGGAGCCAGC ATGGAAAAGG TTTTTGTCCC ACATTGGACC AGGCTTTATG GTCTGTTTGG CTTACCTCGA
TCCTGGAAAT AGTAATATTC TCTCTCTAAA TTTATTTTCT CACACTCATA TGGTTTCTCA CGCTTGACGA ATTGAAACAG
TGGAGACTGA TCTACAAGCT GGTGCCAATC ACAAATATGA GGTACATTCT CTAGCCTTTT CTATATGACT TTTCCTGCCA
TTTATCACAG TTGTCATGTC TTTTGTTACA GCGAGAAGAA AGAAACAATT AACTGATATG CTTCTTGATG TGCTCTTTCA
TATGTTTCTT AGCTTCTTTG GGTGATTTTG ATTGGCCTGA TCTTTGCACT GATTATACAA TCATTATCGG CTAATCTTGG
AGTGGTGACA GGTAATAAAT AGACACTTTC AGCACACAAT TGATTTAACA TTTCAGTTGG AAGTAGCAAG TAATGAATGT
CAATTGATAC AGGGCGCCAT CTTGCTGAGC TGTGCAAGAC TGAATATCCA GTATGGGTGA AAACCTGCTT ATGGCTGCTA
GCAGAACTAG CTGTGATTGC TTCCGATATT CCAGAAGGTT GGAAATAGAA TGATAGATCT AAATAAAAAA AAGTTAATGT
TTAACTGTCA CCTTTGAGTT TCAGTTGATT AAGTTTATAA ACTCTCTCAC TGATATAAGT GTACGAGCAA CACTTGCACT
GATTGTATAC AGTCTCTTAT CCACTAAACA TTATGATATG TAGCACTTTT TCTGAGAAGA AAGCAACAAC ATCTAATCTA
ATATTTGGTG TTTTTTACAC ATGTACCTTT TGTGCAGTTA TAGGTACAGG ATTTGCTTTC AACCTTTTGT TCCACATACC
AGTGTGGACC GGGGTTCTCA TTGCTGGCTC TAGCACGCTT CTTCTTCTTG GACTGCAAAG ATATGGGGTA ACCAACTATT
TATGACTGGA TATATGATAG ATGTCTGTAT AAAATGTTTT AATGAATGTC TAAACATCAT TGTATTGTAT TTGATCATTA
CTGTTTGGTC ATTGTAAATG GTGGTCATTA CAAATGGGTT TGTTGTTGAA TTGACTTGTT TGCATTTTTC CTTCATCTAT
ATAACTAGGT AAGGAAACTG GAGGTTGTGG TCGCGCTATT GGTGTTTGTC ATGGCAGGGT GCTTCTTCGT GGAGATGAGC
ATAGTCAAGC CTCCGGTTAA TGAGGTCCTT CAAGGATTAT TCATCCCCAG GCTCAGTGGG CCCGGTGCCA CAGGAGACTC
CATTGCCCTT CTTGGGGCTC TTGTAATGCC GTAAGCAGTC AAACATGCAT ATATACCCCC AGTTGTTAAT GTGTGCAATG
TCTTTTTTGC GTCTTAAGAT TCTTCTAGGG TAGCTGTAAA CATGCATAAG GTTTTCAACT CTCCAGTAAT TACAAATCTC
CACAATGGTA GTTTTAGTCT TTTTTTAGAT TTTGACAAAA TGCACTCTTG TTAATCATAA GTGAGCATTA TCAGTTATTA
ATTACAGGCA CAATCTATTC TTGCACTCTG CCCTGGTGCT GTCGAGGAAT ACACCCGCAT CAGCAAAAGG AATGAAGGTG
ATCAGATGTC CGTGTTCTTG CATTAAAAAA GAAATGGTAC TCCTAGTTGG CTGATACATA TTCCTTCATT CTTTTGTACT
CCAGGATGTC TGTAGGTTCT TCCTCTTTGA GAGTGGGATA GCTCTTTTCG TGGCTCTGCT TGTCAACATT GCAATCATCT
CTGTCTCCGG CACTGTATGT AATGCAACCA ACCTTTCACC AGAAGATGCT GTAAAATGCA GCGACCTTAC ATTGGACTCC
TCATCCTTCC TCCTCAGGGT ACTGCATATA TGTGCAAAGT TCATCACCAT TTATATTTAG TTGTGTTATT TTCTTCACAA
AAATAAATTA GTCATGTTAT CATTGACCAT ATAATGGTCA TTTACAGAAT TATTATTTAT TTTTTTTTCA GAATGTGCTA
GGAAAGTCAA GTGCGACAGT GTACGGTGTA GCACTCTTGG CTTCTGGACA GAGCTCGACC ATTACTGGCA CTTATGCTGG
GCAATATGTT ATGCAGGTAT ATTTTACCTG AACTCTAACC TTGTTTACAA ATTAACCAAG TACTATCTGT GAACTATTTT
CTTAATGACC AGTTCAAGTG GTATAGTATT AACCACGCAG TAAACTAGAA GATCTCCAAA ATGGTGAAAG AAATGAAAAA
AAGTTTGCAA TCTATCAAGC TTGAATGTAT AGTAACAGTT TTTTTTTTCC ATGTATCTAC AGGGGTTCCT AGACATCAAA
ATGAAACAGT GGCTTCGGAA CCTGATGACA CGCAGCATTG CCATTGTGCC TAGCTTAATC GTCTCCATCA TTGGAGGGTC
TAGTGGCGCC GGTCGTCTCA TCGTCATTGC ATCGGTACAA TCTTTTACTA CAAATGAAAA TATCAGTTTG CCCATAAGAA
CACTCATTAA AAAAAACTGC CATACAATCA ACCATCTTCT AATTTTCTCA ATAATTAGTA AGTTATTTGC TAATCGAAAT
GCTTCTTTCT TCAAAAAATG GACGGTATGT AATTTGTTGT ACCTCATTCC TTCTGATCAT ACTGTTAAAA AGAATCAAAA
CCTAATGCTT GTTTTGGTTT GGCTGTTACG TTTCATACAG ATGATTCTAT CCTTTGAGCT ACCATTTGCT CTGATCCCTC
TTCTCAAGTT CAGCAGCAGC AGCAACAAGA TGGGTGAAAA CAAGAACTCC ATCTATGTAA GCACTCCCCC ATCAATCAAT
CAATCCTTCT TTCTAGCTTG TCCACACATA GAAAACAAAA ACAAAAAAAA TCCTGGAAAA CTAATAATGC ATTGGTAATT
AAAACCTGCA GATTGTTGGA TTCTCCTGGG TGCTGGGGTT CGTCATCATC GGGATAAACA TCTACTTCCT CAGCACAAAG
CTGGTCGGCT GGATCCTCCA CAACGCGCTC CCGACATTCG CCAACGTGCT CATCGGCATC GTGCTGTTCC CGCTCATGCT
GCTCTACGTC GTCGCCGTGA TCTACCTGAC GTTCAGGAAG GACACCGTCA AGTTCGTGTC TCGTCGTGAG CTGCAGGCCG
GCGACGACAC CGAGAAAGCA CAGGTAGCCA CCTGCGTCGC CGACGAGCAC AGCAAAGAGC CACCCGTGTA GTACCCTTCC
AGACCGGTTA CCGGTGTTGG CTGGTTTTTA TTGGATAGAT GTTTAGGTCC AATTTTTTTT ATATAAAAAA TCCAATAGAT
GTTTAGGTCC AAATTTTTGA ATTCAAAAAC CGGTTAGCAG TGATAACCGG CTGAAATTTT GGCCCATGGG AGTAGATTGT
TGCTTTTTTT CTTAGTGATT AGTTATTGGC AGATTGGCAG AATGTTGTAG CTAGGCAATC TAATTGTATG GTTAGATATT
TAGTCATAAA TCCAAGAGTG AGTTTTCTTG GATGCGAGGA CAAGGACAAT CTAATTGTAT GGTTAGATAT TTAGTCATAA
ATCCAAGAGT GAGTTTTCTT GGATGCGAGG ACAAGGACAA ATATAAATGT AAATAAATGC AGTTAAAGTA ACACCTTGCT
CAAATATAAA TGTAAATAAA TGCAGTTAAA GT