Os07t0258400-02

Locus

Os07g0258400

Description

Similar to Metal transporter.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NRAMP1

CGSNL Gene Name

BACTERIOCIDE EFFECT 1

Oryzabase Gene Symbol Synonym(s)

OsNramp1, OsNRAMP1, OsNramp6

Oryzabase Gene Name Synonym(s)

homologues of mammalian Nramp1 gene

Transcript Evidence

AK103557 (DDBJ, Best hit)

Protein Evidence

Q0D7E4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transport (GO:0006810)

Cellular Component: membrane (GO:0016020)

Molecular Function: transporter activity (GO:0005215)

Functional domain (InterPro)

Natural resistance-associated macrophage protein (IPR001046)

Full-length cDNA

J033132H19 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0258400-02)

RiceXPro (AK103557)

Others

Oryzabase (6243)

KEGG (Os07t0258400-02)

Transcript

1359 bp

>Os07t0258400-02 Similar to Metal transporter.
TTGCTTTCAACCTTTTGTTCCACATACCAGTGTGGACCGGGGTTCTCATTGCTGGCTCTA
GCACGCTTCTTCTTCTTGGACTGCAAAGATATGGGGTAAGGAAACTGGAGGTTGTGGTCG
CGCTATTGGTGTTTGTCATGGCAGGGTGCTTCTTCGTGGAGATGAGCATAGTCAAGCCTC
CGGTTAATGAGGTCCTTCAAGGATTATTCATCCCCAGGCTCAGTGGGCCCGGTGCCACAG
GAGACTCCATTGCCCTTCTTGGGGCTCTTGTAATGCCGCACAATCTATTCTTGCACTCTG
CCCTGGTGCTGTCGAGGAATACACCCGCATCAGCAAAAGGAATGAAGGATGTCTGTAGGT
TCTTCCTCTTTGAGAGTGGGATAGCTCTTTTCGTGGCTCTGCTTGTCAACATTGCAATCA
TCTCTGTCTCCGGCACTGTATGTAATGCAACCAACCTTTCACCAGAAGATGCTGTAAAAT
GCAGCGACCTTACATTGGACTCCTCATCCTTCCTCCTCAGGAATGTGCTAGGAAAGTCAA
GTGCGACAGTGTACGGTGTAGCACTCTTGGCTTCTGGACAGAGCTCGACCATTACTGGCA
CTTATGCTGGGCAATATGTTATGCAGGGGTTCCTAGACATCAAAATGAAACAGTGGCTTC
GGAACCTGATGACACGCAGCATTGCCATTGTGCCTAGCTTAATCGTCTCCATCATTGGAG
GGTCTAGTGGCGCCGGTCGTCTCATCGTCATTGCATCGATGATTCTATCCTTTGAGCTAC
CATTTGCTCTGATCCCTCTTCTCAAGTTCAGCAGCAGCAGCAACAAGATGGGTGAAAACA
AGAACTCCATCTATATTGTTGGATTCTCCTGGGTGCTGGGGTTCGTCATCATCGGGATAA
ACATCTACTTCCTCAGCACAAAGCTGGTCGGCTGGATCCTCCACAACGCGCTCCCGACAT
TCGCCAACGTGCTCATCGGCATCGTGCTGTTCCCGCTCATGCTGCTCTACGTCGTCGCCG
TGATCTACCTGACGTTCAGGAAGGACACCGTCAAGTTCGTGTCTCGTCGTGAGCTGCAGG
CCGGCGACGACACCGAGAAAGCACAGGTAGCCACCTGCGTCGCCGACGAGCACAGCAAAG
AGCCACCCGTGTAGTACCCTTCCAGACCGGTTACCGGTGTTGGCTGGTTTTTATTGGATA
GATGTTTAGGTCCAATTTTTTTTATATAAAAAATCCAATAGATGTTTAGGTCCAAATTTT
TGAATTCAAAAACCGGTTAGCAGTGATAACCGGCTGAAATTTTGGCCCATGGGAGTAGAT
TGTTGCTTTTTTTCTTAGTGATTAGTTATTGGCAGATTG

CDS

1152 bp

>Os07t0258400-02 Similar to Metal transporter.
GCTTTCAACCTTTTGTTCCACATACCAGTGTGGACCGGGGTTCTCATTGCTGGCTCTAGC
ACGCTTCTTCTTCTTGGACTGCAAAGATATGGGGTAAGGAAACTGGAGGTTGTGGTCGCG
CTATTGGTGTTTGTCATGGCAGGGTGCTTCTTCGTGGAGATGAGCATAGTCAAGCCTCCG
GTTAATGAGGTCCTTCAAGGATTATTCATCCCCAGGCTCAGTGGGCCCGGTGCCACAGGA
GACTCCATTGCCCTTCTTGGGGCTCTTGTAATGCCGCACAATCTATTCTTGCACTCTGCC
CTGGTGCTGTCGAGGAATACACCCGCATCAGCAAAAGGAATGAAGGATGTCTGTAGGTTC
TTCCTCTTTGAGAGTGGGATAGCTCTTTTCGTGGCTCTGCTTGTCAACATTGCAATCATC
TCTGTCTCCGGCACTGTATGTAATGCAACCAACCTTTCACCAGAAGATGCTGTAAAATGC
AGCGACCTTACATTGGACTCCTCATCCTTCCTCCTCAGGAATGTGCTAGGAAAGTCAAGT
GCGACAGTGTACGGTGTAGCACTCTTGGCTTCTGGACAGAGCTCGACCATTACTGGCACT
TATGCTGGGCAATATGTTATGCAGGGGTTCCTAGACATCAAAATGAAACAGTGGCTTCGG
AACCTGATGACACGCAGCATTGCCATTGTGCCTAGCTTAATCGTCTCCATCATTGGAGGG
TCTAGTGGCGCCGGTCGTCTCATCGTCATTGCATCGATGATTCTATCCTTTGAGCTACCA
TTTGCTCTGATCCCTCTTCTCAAGTTCAGCAGCAGCAGCAACAAGATGGGTGAAAACAAG
AACTCCATCTATATTGTTGGATTCTCCTGGGTGCTGGGGTTCGTCATCATCGGGATAAAC
ATCTACTTCCTCAGCACAAAGCTGGTCGGCTGGATCCTCCACAACGCGCTCCCGACATTC
GCCAACGTGCTCATCGGCATCGTGCTGTTCCCGCTCATGCTGCTCTACGTCGTCGCCGTG
ATCTACCTGACGTTCAGGAAGGACACCGTCAAGTTCGTGTCTCGTCGTGAGCTGCAGGCC
GGCGACGACACCGAGAAAGCACAGGTAGCCACCTGCGTCGCCGACGAGCACAGCAAAGAG
CCACCCGTGTAG

Protein

384 aa

>Os07t0258400-02 Similar to Metal transporter.
AFNLLFHIPVWTGVLIAGSSTLLLLGLQRYGVRKLEVVVALLVFVMAGCFFVEMSIVKPP
VNEVLQGLFIPRLSGPGATGDSIALLGALVMPHNLFLHSALVLSRNTPASAKGMKDVCRF
FLFESGIALFVALLVNIAIISVSGTVCNATNLSPEDAVKCSDLTLDSSSFLLRNVLGKSS
ATVYGVALLASGQSSTITGTYAGQYVMQGFLDIKMKQWLRNLMTRSIAIVPSLIVSIIGG
SSGAGRLIVIASMILSFELPFALIPLLKFSSSSNKMGENKNSIYIVGFSWVLGFVIIGIN
IYFLSTKLVGWILHNALPTFANVLIGIVLFPLMLLYVVAVIYLTFRKDTVKFVSRRELQA
GDDTEKAQVATCVADEHSKEPPV*

5'UTR

chr07:8968077..8968078 (+ strand) : 2 bp

CDS

chr07:8968079..8968171 (+ strand) : 93 bp

chr07:8968353..8968534 (+ strand) : 182 bp

chr07:8968752..8968821 (+ strand) : 70 bp

chr07:8968909..8969082 (+ strand) : 174 bp

chr07:8969216..8969320 (+ strand) : 105 bp

chr07:8969527..8969658 (+ strand) : 132 bp

chr07:8969905..8970000 (+ strand) : 96 bp

chr07:8970116..8970415 (+ strand) : 300 bp

3'UTR

chr07:8970416..8970620 (+ strand) : 205 bp

FASTA

>Os07t0258400-02 class=Sequence position=chr07:8968077..8970620 (+ strand)
TTGCTTTCAA CCTTTTGTTC CACATACCAG TGTGGACCGG GGTTCTCATT GCTGGCTCTA GCACGCTTCT TCTTCTTGGA
CTGCAAAGAT ATGGGGTAAC CAACTATTTA TGACTGGATA TATGATAGAT GTCTGTATAA AATGTTTTAA TGAATGTCTA
AACATCATTG TATTGTATTT GATCATTACT GTTTGGTCAT TGTAAATGGT GGTCATTACA AATGGGTTTG TTGTTGAATT
GACTTGTTTG CATTTTTCCT TCATCTATAT AACTAGGTAA GGAAACTGGA GGTTGTGGTC GCGCTATTGG TGTTTGTCAT
GGCAGGGTGC TTCTTCGTGG AGATGAGCAT AGTCAAGCCT CCGGTTAATG AGGTCCTTCA AGGATTATTC ATCCCCAGGC
TCAGTGGGCC CGGTGCCACA GGAGACTCCA TTGCCCTTCT TGGGGCTCTT GTAATGCCGT AAGCAGTCAA ACATGCATAT
ATACCCCCAG TTGTTAATGT GTGCAATGTC TTTTTTGCGT CTTAAGATTC TTCTAGGGTA GCTGTAAACA TGCATAAGGT
TTTCAACTCT CCAGTAATTA CAAATCTCCA CAATGGTAGT TTTAGTCTTT TTTTAGATTT TGACAAAATG CACTCTTGTT
AATCATAAGT GAGCATTATC AGTTATTAAT TACAGGCACA ATCTATTCTT GCACTCTGCC CTGGTGCTGT CGAGGAATAC
ACCCGCATCA GCAAAAGGAA TGAAGGTGAT CAGATGTCCG TGTTCTTGCA TTAAAAAAGA AATGGTACTC CTAGTTGGCT
GATACATATT CCTTCATTCT TTTGTACTCC AGGATGTCTG TAGGTTCTTC CTCTTTGAGA GTGGGATAGC TCTTTTCGTG
GCTCTGCTTG TCAACATTGC AATCATCTCT GTCTCCGGCA CTGTATGTAA TGCAACCAAC CTTTCACCAG AAGATGCTGT
AAAATGCAGC GACCTTACAT TGGACTCCTC ATCCTTCCTC CTCAGGGTAC TGCATATATG TGCAAAGTTC ATCACCATTT
ATATTTAGTT GTGTTATTTT CTTCACAAAA ATAAATTAGT CATGTTATCA TTGACCATAT AATGGTCATT TACAGAATTA
TTATTTATTT TTTTTTCAGA ATGTGCTAGG AAAGTCAAGT GCGACAGTGT ACGGTGTAGC ACTCTTGGCT TCTGGACAGA
GCTCGACCAT TACTGGCACT TATGCTGGGC AATATGTTAT GCAGGTATAT TTTACCTGAA CTCTAACCTT GTTTACAAAT
TAACCAAGTA CTATCTGTGA ACTATTTTCT TAATGACCAG TTCAAGTGGT ATAGTATTAA CCACGCAGTA AACTAGAAGA
TCTCCAAAAT GGTGAAAGAA ATGAAAAAAA GTTTGCAATC TATCAAGCTT GAATGTATAG TAACAGTTTT TTTTTTCCAT
GTATCTACAG GGGTTCCTAG ACATCAAAAT GAAACAGTGG CTTCGGAACC TGATGACACG CAGCATTGCC ATTGTGCCTA
GCTTAATCGT CTCCATCATT GGAGGGTCTA GTGGCGCCGG TCGTCTCATC GTCATTGCAT CGGTACAATC TTTTACTACA
AATGAAAATA TCAGTTTGCC CATAAGAACA CTCATTAAAA AAAACTGCCA TACAATCAAC CATCTTCTAA TTTTCTCAAT
AATTAGTAAG TTATTTGCTA ATCGAAATGC TTCTTTCTTC AAAAAATGGA CGGTATGTAA TTTGTTGTAC CTCATTCCTT
CTGATCATAC TGTTAAAAAG AATCAAAACC TAATGCTTGT TTTGGTTTGG CTGTTACGTT TCATACAGAT GATTCTATCC
TTTGAGCTAC CATTTGCTCT GATCCCTCTT CTCAAGTTCA GCAGCAGCAG CAACAAGATG GGTGAAAACA AGAACTCCAT
CTATGTAAGC ACTCCCCCAT CAATCAATCA ATCCTTCTTT CTAGCTTGTC CACACATAGA AAACAAAAAC AAAAAAAATC
CTGGAAAACT AATAATGCAT TGGTAATTAA AACCTGCAGA TTGTTGGATT CTCCTGGGTG CTGGGGTTCG TCATCATCGG
GATAAACATC TACTTCCTCA GCACAAAGCT GGTCGGCTGG ATCCTCCACA ACGCGCTCCC GACATTCGCC AACGTGCTCA
TCGGCATCGT GCTGTTCCCG CTCATGCTGC TCTACGTCGT CGCCGTGATC TACCTGACGT TCAGGAAGGA CACCGTCAAG
TTCGTGTCTC GTCGTGAGCT GCAGGCCGGC GACGACACCG AGAAAGCACA GGTAGCCACC TGCGTCGCCG ACGAGCACAG
CAAAGAGCCA CCCGTGTAGT ACCCTTCCAG ACCGGTTACC GGTGTTGGCT GGTTTTTATT GGATAGATGT TTAGGTCCAA
TTTTTTTTAT ATAAAAAATC CAATAGATGT TTAGGTCCAA ATTTTTGAAT TCAAAAACCG GTTAGCAGTG ATAACCGGCT
GAAATTTTGG CCCATGGGAG TAGATTGTTG CTTTTTTTCT TAGTGATTAG TTATTGGCAG ATTG