Os07t0258400-03

Locus

Os07g0258400

Description

Integral membrane protein, Metal ion transport

RAP-DB Gene Symbol Synonym(s)

NRAMP1, OsNramp1, OsNRAMP1

RAP-DB Gene Name Synonym(s)

BACTERIOCIDE EFFECT 1, Oryza sativa natural resistance-associated macrophage protein 1, homologues of mammalian Nramp1 gene

CGSNL Gene Symbol

NRAMP1

CGSNL Gene Name

BACTERIOCIDE EFFECT 1

Oryzabase Gene Symbol Synonym(s)

OsNramp1, OsNRAMP1, OsNramp6

Oryzabase Gene Name Synonym(s)

homologues of mammalian Nramp1 gene

Transcript Evidence

L41217 (Genbank)

S81697 (Genbank)

Protein Evidence

Q41268 (UniProt)

Literature

PMID: 8616217

PMID: 9154989

Note

Manual Curation

August 2, 2009

Gene Ontology (GO)

Biological Process: transport (GO:0006810)

Cellular Component: membrane (GO:0016020)

Molecular Function: transporter activity (GO:0005215)

Functional domain (InterPro)

Natural resistance-associated macrophage protein (IPR001046)

Others

Oryzabase (6243)

Transcript

1985 bp

>Os07t0258400-03 Integral membrane protein, Metal ion transport
TCGGGGTTCGGCGCCGGCGGCGAGTTGTTGAGAGGCAAGGCAAACTCAGGCGACTGAGCT
AAAGAAGCCGCACTAGTATGGGGGTGACGAAGGCGGAGGCGGTTGCCGGCGACGGCGGGA
AGGTGGTGGACGACATCGAGGCGCTCGCCGATCTCAGAAAGGAGCCAGCATGGAAAAGGT
TTTTGTCCCACATTGGACCAGGCTTTATGGTCTGTTTGGCTTACCTCGATCCTGGAAATA
TGGAGACTGATCTACAAGCTGGTGCCAATCACAAATATGAGCTTCTTTGGGTGATTTTGA
TTGGCCTGATCTTTGCACTGATTATACAATCATTATCGGCTAATCTTGGAGTGGTGACAG
GGCGCCATCTTGCTGAGCTGTGCAAGACTGAATATCCAGTATGGGTGAAAACCTGCTTAT
GGCTGCTAGCAGAACTAGCTGTGATTGCTTCCGATATTCCAGAAGTTATAGGTACAGGAT
TTGCTTTCAACCTTTTGTTCCACATACCAGTGTGGACCGGGGTTCTCATTGCTGGCTCTA
GCACGCTTCTTCTTCTTGGACTGCAAAGATATGGGGTAAGGAAACTGGAGGTTGTGGTCG
CGCTATTGGTGTTTGTCATGGCAGGGTGCTTCTTCGTGGAGATGAGCATAGTCAAGCCTC
CGGTTAATGAGGTCCTTCAAGGATTATTCATCCCCAGGCTCAGTGGGCCCGGTGCCACAG
GAGACTCCATTGCCCTTCTTGGGGCTCTTGTAATGCCGCACAATCTATTCTTGCACTCTG
CCCTGGTGCTGTCGAGGAATACACCCGCATCAGCAAAAGGAATGAAGGATGTCTGTAGGT
TCTTCCTCTTTGAGAGTGGGATAGCTCTTTTCGTGGCTCTGCTTGTCAACATTGCAATCA
TCTCTGTCTCCGGCACTGTATGTAATGCAACCAACCTTTCACCAGAAGATGCTGTAAAAT
GCAGCGACCTTACATTGGACTCCTCATCCTTCCTCCTCAGGAATGTGCTAGGAAAGTCAA
GTGCGACAGTGTACGGTGTAGCACTCTTGGCTTCTGGACAGAGCTCGACCATTACTGGCA
CTTATGCTGGGCAATATGTTATGCAGGGGTTCCTAGACATCAAAATGAAACAGTGGCTTC
GGAACCTGATGACACGCAGCATTGCCATTGTGCCTAGCTTAATCGTCTCCATCATTGGAG
GGTCTAGTGGCGCCGGTCGTCTCATCGTCATTGCATCGATGATTCTATCCTTTGAGCTAC
CATTTGCTCTGATCCCTCTTCTCAAGTTCAGCAGCAGCAGCAACAAGATGGGTGAAAACA
AGAACTCCATCTATATTGTTGGATTCTCCTGGGTGCTGGGGTTCGTCATCATCGGGATAA
ACATCTACTTCCTCAGCACAAAGCTGGTCGGCTGGATCCTCCACAACGCGCTCCCGACAT
TCGCCAACGTGCTCATCGGCATCGTGCTGTTCCCGCTCATGCTGCTCTACGTCGTCGCCG
TGATCTACCTGACGTTCAGGAAGGACACCGTCAAGTTCGTGTCTCGTCGTGAGCTGCAGG
CCGGCGACGACACCGAGAAAGCACAGGTAGCCACCTGCGTCGCCGACGAGCACAGCAAAG
AGCCACCCGTGTAGTACCCTTCCAGACCGGTTACCGGTGTTGGCTGGTTTTTATTGGATA
GATGTTTAGGTCCAATTTTTTTTATATAAAAAATCCAATAGATGTTTAGGTCCAAATTTT
TGAATTCAAAAACCGGTTAGCAGTGATAACCGGCTGAAATTTTGGCCCATGGGAGTAGAT
TGTTGCTTTTTTTCTTAGTGATTAGTTATTGGCAGATTGGCAGAATGTTGTAGCTAGGCA
ATCTAATTGTATGGTTAGATATTTAGTCATAAATCCAAGAGTGAGTTTTCTTGGATGCGA
GGACAAGGACAAATATAAATGTAAATAAATGCAGTTAAAGTAACACCTTGCTCCTTGTGG
ACATC

CDS

1557 bp

>Os07t0258400-03 Integral membrane protein, Metal ion transport
ATGGGGGTGACGAAGGCGGAGGCGGTTGCCGGCGACGGCGGGAAGGTGGTGGACGACATC
GAGGCGCTCGCCGATCTCAGAAAGGAGCCAGCATGGAAAAGGTTTTTGTCCCACATTGGA
CCAGGCTTTATGGTCTGTTTGGCTTACCTCGATCCTGGAAATATGGAGACTGATCTACAA
GCTGGTGCCAATCACAAATATGAGCTTCTTTGGGTGATTTTGATTGGCCTGATCTTTGCA
CTGATTATACAATCATTATCGGCTAATCTTGGAGTGGTGACAGGGCGCCATCTTGCTGAG
CTGTGCAAGACTGAATATCCAGTATGGGTGAAAACCTGCTTATGGCTGCTAGCAGAACTA
GCTGTGATTGCTTCCGATATTCCAGAAGTTATAGGTACAGGATTTGCTTTCAACCTTTTG
TTCCACATACCAGTGTGGACCGGGGTTCTCATTGCTGGCTCTAGCACGCTTCTTCTTCTT
GGACTGCAAAGATATGGGGTAAGGAAACTGGAGGTTGTGGTCGCGCTATTGGTGTTTGTC
ATGGCAGGGTGCTTCTTCGTGGAGATGAGCATAGTCAAGCCTCCGGTTAATGAGGTCCTT
CAAGGATTATTCATCCCCAGGCTCAGTGGGCCCGGTGCCACAGGAGACTCCATTGCCCTT
CTTGGGGCTCTTGTAATGCCGCACAATCTATTCTTGCACTCTGCCCTGGTGCTGTCGAGG
AATACACCCGCATCAGCAAAAGGAATGAAGGATGTCTGTAGGTTCTTCCTCTTTGAGAGT
GGGATAGCTCTTTTCGTGGCTCTGCTTGTCAACATTGCAATCATCTCTGTCTCCGGCACT
GTATGTAATGCAACCAACCTTTCACCAGAAGATGCTGTAAAATGCAGCGACCTTACATTG
GACTCCTCATCCTTCCTCCTCAGGAATGTGCTAGGAAAGTCAAGTGCGACAGTGTACGGT
GTAGCACTCTTGGCTTCTGGACAGAGCTCGACCATTACTGGCACTTATGCTGGGCAATAT
GTTATGCAGGGGTTCCTAGACATCAAAATGAAACAGTGGCTTCGGAACCTGATGACACGC
AGCATTGCCATTGTGCCTAGCTTAATCGTCTCCATCATTGGAGGGTCTAGTGGCGCCGGT
CGTCTCATCGTCATTGCATCGATGATTCTATCCTTTGAGCTACCATTTGCTCTGATCCCT
CTTCTCAAGTTCAGCAGCAGCAGCAACAAGATGGGTGAAAACAAGAACTCCATCTATATT
GTTGGATTCTCCTGGGTGCTGGGGTTCGTCATCATCGGGATAAACATCTACTTCCTCAGC
ACAAAGCTGGTCGGCTGGATCCTCCACAACGCGCTCCCGACATTCGCCAACGTGCTCATC
GGCATCGTGCTGTTCCCGCTCATGCTGCTCTACGTCGTCGCCGTGATCTACCTGACGTTC
AGGAAGGACACCGTCAAGTTCGTGTCTCGTCGTGAGCTGCAGGCCGGCGACGACACCGAG
AAAGCACAGGTAGCCACCTGCGTCGCCGACGAGCACAGCAAAGAGCCACCCGTGTAG

Protein

519 aa

>Os07t0258400-03 Integral membrane protein, Metal ion transport
MGVTKAEAVAGDGGKVVDDIEALADLRKEPAWKRFLSHIGPGFMVCLAYLDPGNMETDLQ
AGANHKYELLWVILIGLIFALIIQSLSANLGVVTGRHLAELCKTEYPVWVKTCLWLLAEL
AVIASDIPEVIGTGFAFNLLFHIPVWTGVLIAGSSTLLLLGLQRYGVRKLEVVVALLVFV
MAGCFFVEMSIVKPPVNEVLQGLFIPRLSGPGATGDSIALLGALVMPHNLFLHSALVLSR
NTPASAKGMKDVCRFFLFESGIALFVALLVNIAIISVSGTVCNATNLSPEDAVKCSDLTL
DSSSFLLRNVLGKSSATVYGVALLASGQSSTITGTYAGQYVMQGFLDIKMKQWLRNLMTR
SIAIVPSLIVSIIGGSSGAGRLIVIASMILSFELPFALIPLLKFSSSSNKMGENKNSIYI
VGFSWVLGFVIIGINIYFLSTKLVGWILHNALPTFANVLIGIVLFPLMLLYVVAVIYLTF
RKDTVKFVSRRELQAGDDTEKAQVATCVADEHSKEPPV*

5'UTR

chr07:8966032..8966108 (+ strand) : 77 bp

CDS

chr07:8966109..8966192 (+ strand) : 84 bp

chr07:8967237..8967315 (+ strand) : 79 bp

chr07:8967385..8967425 (+ strand) : 41 bp

chr07:8967557..8967635 (+ strand) : 79 bp

chr07:8967717..8967821 (+ strand) : 105 bp

chr07:8968062..8968171 (+ strand) : 110 bp

chr07:8968353..8968534 (+ strand) : 182 bp

chr07:8968752..8968821 (+ strand) : 70 bp

chr07:8968909..8969082 (+ strand) : 174 bp

chr07:8969216..8969320 (+ strand) : 105 bp

chr07:8969527..8969658 (+ strand) : 132 bp

chr07:8969905..8970000 (+ strand) : 96 bp

chr07:8970116..8970415 (+ strand) : 300 bp

3'UTR

chr07:8970416..8970712 (+ strand) : 297 bp

chr07:8970827..8970880 (+ strand) : 54 bp

FASTA

>Os07t0258400-03 class=Sequence position=chr07:8966032..8970880 (+ strand)
TCGGGGTTCG GCGCCGGCGG CGAGTTGTTG AGAGGCAAGG CAAACTCAGG CGACTGAGCT AAAGAAGCCG CACTAGTATG
GGGGTGACGA AGGCGGAGGC GGTTGCCGGC GACGGCGGGA AGGTGGTGGA CGACATCGAG GCGCTCGCCG ATCTCAGAAA
GGTTAATTCT CTCTGCAAAT ACTCCTGGTT GCTCATACTT AAATCTACCT ATGAATGAGG GATCGCATCG ATGTCGCAGT
TGGAGTTGGA CGGACAGGAG TGAGAAATTA TTATCTCTGA TCTGATTCCT GTTGGTATGC ACTCTTGCTG TTTGTGAAAA
TGCCCCAGAG GATGCATCCA CAGGACACGG CGCCTTCAAT ATTTATAAGT TGATTCAATG ATGGGTTTCT TTCATGTTTC
TTTGCTGAAA AATCGTGTTT AGTAGAGTAG TCTTCTATGT CTCTATTCAA AAGAAAAGTG GCATTAAGTT ATAGGAGAAA
ATAAAAGGGA GAAGTCGTTT TGTTAATTAG GAGCTTCTCC TTTCGATAAC TATGACTTAA TAGTTCATTT TTATTATGGA
ACAAAGATGA GATACAAAAC AATAGATTGT GATCACCTCA GTTTTTTTGT TTGATATCAA GTCTGACAAA CTAAGGCATT
ACGGTTCTCT GCTCTTGTTT GACAAACGAA GTCTATTGTA CAATAGAAGT CTGTTGTTTA ATGTCTCTAC TTTTGGTCAT
CTCTTGTATG GTTTAGCCTA GATCTCAGTT TATCTTACTA TAGGTCGCCG ATAGTACAAT ATGATTTGTT TCTCCGCCGT
ACCTAATCCA AAATCATATA GCTTGACATT ATCTGCTTCG CATAGATGTT CGTTATAAGC TTCAAATTAC AAATTTCATA
TTGAAAGTTT AGCCTCTTCT TGTTGGACTA TAATAGCGAG TCCATGTGAA CATCATTTCT TACATTAATA TACATTTCTT
CACATTTGTG GCTAGTTATT TTACTTGCCC TACCATTGTC GCATTTATTT ATATTTCCAT AACTCATTTT CCAATGCTTA
GTTGAATGTA TCATTCACTC ATTCTTGTAT TGTTTGTACG TCTTTGAGAC TTTGACTGAA AATAGTCTTA GTTTTGTACC
TATTTTATAT TTTGCTTTAT GTTTTAATTA TTTTCTTTGA CATGATGTGC ATGCATATTT ATTACTAATT GGTCATGTAA
CACAGGAGCC AGCATGGAAA AGGTTTTTGT CCCACATTGG ACCAGGCTTT ATGGTCTGTT TGGCTTACCT CGATCCTGGA
AATAGTAATA TTCTCTCTCT AAATTTATTT TCTCACACTC ATATGGTTTC TCACGCTTGA CGAATTGAAA CAGTGGAGAC
TGATCTACAA GCTGGTGCCA ATCACAAATA TGAGGTACAT TCTCTAGCCT TTTCTATATG ACTTTTCCTG CCATTTATCA
CAGTTGTCAT GTCTTTTGTT ACAGCGAGAA GAAAGAAACA ATTAACTGAT ATGCTTCTTG ATGTGCTCTT TCATATGTTT
CTTAGCTTCT TTGGGTGATT TTGATTGGCC TGATCTTTGC ACTGATTATA CAATCATTAT CGGCTAATCT TGGAGTGGTG
ACAGGTAATA AATAGACACT TTCAGCACAC AATTGATTTA ACATTTCAGT TGGAAGTAGC AAGTAATGAA TGTCAATTGA
TACAGGGCGC CATCTTGCTG AGCTGTGCAA GACTGAATAT CCAGTATGGG TGAAAACCTG CTTATGGCTG CTAGCAGAAC
TAGCTGTGAT TGCTTCCGAT ATTCCAGAAG GTTGGAAATA GAATGATAGA TCTAAATAAA AAAAAGTTAA TGTTTAACTG
TCACCTTTGA GTTTCAGTTG ATTAAGTTTA TAAACTCTCT CACTGATATA AGTGTACGAG CAACACTTGC ACTGATTGTA
TACAGTCTCT TATCCACTAA ACATTATGAT ATGTAGCACT TTTTCTGAGA AGAAAGCAAC AACATCTAAT CTAATATTTG
GTGTTTTTTA CACATGTACC TTTTGTGCAG TTATAGGTAC AGGATTTGCT TTCAACCTTT TGTTCCACAT ACCAGTGTGG
ACCGGGGTTC TCATTGCTGG CTCTAGCACG CTTCTTCTTC TTGGACTGCA AAGATATGGG GTAACCAACT ATTTATGACT
GGATATATGA TAGATGTCTG TATAAAATGT TTTAATGAAT GTCTAAACAT CATTGTATTG TATTTGATCA TTACTGTTTG
GTCATTGTAA ATGGTGGTCA TTACAAATGG GTTTGTTGTT GAATTGACTT GTTTGCATTT TTCCTTCATC TATATAACTA
GGTAAGGAAA CTGGAGGTTG TGGTCGCGCT ATTGGTGTTT GTCATGGCAG GGTGCTTCTT CGTGGAGATG AGCATAGTCA
AGCCTCCGGT TAATGAGGTC CTTCAAGGAT TATTCATCCC CAGGCTCAGT GGGCCCGGTG CCACAGGAGA CTCCATTGCC
CTTCTTGGGG CTCTTGTAAT GCCGTAAGCA GTCAAACATG CATATATACC CCCAGTTGTT AATGTGTGCA ATGTCTTTTT
TGCGTCTTAA GATTCTTCTA GGGTAGCTGT AAACATGCAT AAGGTTTTCA ACTCTCCAGT AATTACAAAT CTCCACAATG
GTAGTTTTAG TCTTTTTTTA GATTTTGACA AAATGCACTC TTGTTAATCA TAAGTGAGCA TTATCAGTTA TTAATTACAG
GCACAATCTA TTCTTGCACT CTGCCCTGGT GCTGTCGAGG AATACACCCG CATCAGCAAA AGGAATGAAG GTGATCAGAT
GTCCGTGTTC TTGCATTAAA AAAGAAATGG TACTCCTAGT TGGCTGATAC ATATTCCTTC ATTCTTTTGT ACTCCAGGAT
GTCTGTAGGT TCTTCCTCTT TGAGAGTGGG ATAGCTCTTT TCGTGGCTCT GCTTGTCAAC ATTGCAATCA TCTCTGTCTC
CGGCACTGTA TGTAATGCAA CCAACCTTTC ACCAGAAGAT GCTGTAAAAT GCAGCGACCT TACATTGGAC TCCTCATCCT
TCCTCCTCAG GGTACTGCAT ATATGTGCAA AGTTCATCAC CATTTATATT TAGTTGTGTT ATTTTCTTCA CAAAAATAAA
TTAGTCATGT TATCATTGAC CATATAATGG TCATTTACAG AATTATTATT TATTTTTTTT TCAGAATGTG CTAGGAAAGT
CAAGTGCGAC AGTGTACGGT GTAGCACTCT TGGCTTCTGG ACAGAGCTCG ACCATTACTG GCACTTATGC TGGGCAATAT
GTTATGCAGG TATATTTTAC CTGAACTCTA ACCTTGTTTA CAAATTAACC AAGTACTATC TGTGAACTAT TTTCTTAATG
ACCAGTTCAA GTGGTATAGT ATTAACCACG CAGTAAACTA GAAGATCTCC AAAATGGTGA AAGAAATGAA AAAAAGTTTG
CAATCTATCA AGCTTGAATG TATAGTAACA GTTTTTTTTT TCCATGTATC TACAGGGGTT CCTAGACATC AAAATGAAAC
AGTGGCTTCG GAACCTGATG ACACGCAGCA TTGCCATTGT GCCTAGCTTA ATCGTCTCCA TCATTGGAGG GTCTAGTGGC
GCCGGTCGTC TCATCGTCAT TGCATCGGTA CAATCTTTTA CTACAAATGA AAATATCAGT TTGCCCATAA GAACACTCAT
TAAAAAAAAC TGCCATACAA TCAACCATCT TCTAATTTTC TCAATAATTA GTAAGTTATT TGCTAATCGA AATGCTTCTT
TCTTCAAAAA ATGGACGGTA TGTAATTTGT TGTACCTCAT TCCTTCTGAT CATACTGTTA AAAAGAATCA AAACCTAATG
CTTGTTTTGG TTTGGCTGTT ACGTTTCATA CAGATGATTC TATCCTTTGA GCTACCATTT GCTCTGATCC CTCTTCTCAA
GTTCAGCAGC AGCAGCAACA AGATGGGTGA AAACAAGAAC TCCATCTATG TAAGCACTCC CCCATCAATC AATCAATCCT
TCTTTCTAGC TTGTCCACAC ATAGAAAACA AAAACAAAAA AAATCCTGGA AAACTAATAA TGCATTGGTA ATTAAAACCT
GCAGATTGTT GGATTCTCCT GGGTGCTGGG GTTCGTCATC ATCGGGATAA ACATCTACTT CCTCAGCACA AAGCTGGTCG
GCTGGATCCT CCACAACGCG CTCCCGACAT TCGCCAACGT GCTCATCGGC ATCGTGCTGT TCCCGCTCAT GCTGCTCTAC
GTCGTCGCCG TGATCTACCT GACGTTCAGG AAGGACACCG TCAAGTTCGT GTCTCGTCGT GAGCTGCAGG CCGGCGACGA
CACCGAGAAA GCACAGGTAG CCACCTGCGT CGCCGACGAG CACAGCAAAG AGCCACCCGT GTAGTACCCT TCCAGACCGG
TTACCGGTGT TGGCTGGTTT TTATTGGATA GATGTTTAGG TCCAATTTTT TTTATATAAA AAATCCAATA GATGTTTAGG
TCCAAATTTT TGAATTCAAA AACCGGTTAG CAGTGATAAC CGGCTGAAAT TTTGGCCCAT GGGAGTAGAT TGTTGCTTTT
TTTCTTAGTG ATTAGTTATT GGCAGATTGG CAGAATGTTG TAGCTAGGCA ATCTAATTGT ATGGTTAGAT ATTTAGTCAT
AAATCCAAGA GTGAGTTTTC TTGGATGCGA GGACAAGGAC AATCTAATTG TATGGTTAGA TATTTAGTCA TAAATCCAAG
AGTGAGTTTT CTTGGATGCG AGGACAAGGA CAAATATAAA TGTAAATAAA TGCAGTTAAA GTAACACCTT GCTCAAATAT
AAATGTAAAT AAATGCAGTT AAAGTAACAC CTTGCTCCTT GTGGACATC