Os07t0261200-01

Locus

Os07g0261200

Description

CCT(CONSTANS, CONSTANS-LIKE, and TIMING OF CHLOROPHYLL A/B BINDING1) domain protein, Heading date, Long-day repression, Regulator of growth, development, and stress-response

RAP-DB Gene Symbol Synonym(s)

GHD7, Ghd2, Ghd7, OsCCT26, OsCMF8, OsI

RAP-DB Gene Name Synonym(s)

HEADING DATE 7, heading date 7, "Grain number, plant height, and heading date 7", "GRAIN NUMBER, PLANT HEIGHT AND HEADING DATE 7", CCT domain-containing gene 26, CCT (CO, CO-LIKE and TOC1) domain protein 26, CCT domain protein 26, CCT MOTIF FAMILY (CMF) gene 8

CGSNL Gene Symbol

GHD7

CGSNL Gene Name

HEADING DATE 7

Oryzabase Gene Symbol Synonym(s)

Ghd2, Ghd7, OsCCT26, OsCMF8, OsI, Ghd7/Hd4, Hd4, EH7-1/Hd4, Ghd7-0a, EH7-1, EH7/Ghd7, EH7, OsEH7

Oryzabase Gene Name Synonym(s)

heading date 7, "Grain number, plant height, and heading date7", "GRAIN NUMBER, PLANT HEIGHT AND HEADING DATE 7", CCT domain-containing gene 26, CCT (CO, CO-LIKE and TOC1) domain protein 26, CCT domain protein 26, CCT MOTIF FAMILY (CMF) gene 8, Early heading 7

Transcript Evidence

EU286800 (Minghui 63)

Protein Evidence

B2KYD3

G3GJX4

Literature

PMID: 18454147

PMID: 20543848

PMID: 24390391

Note

Manual Curation

May 19, 2014

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

CCT domain (IPR010402)

Expression Databases

TENOR (Os07t0261200-00)

Others

Oryzabase (8136)

Transcript

1009 bp

>Os07t0261200-01 CCT(CONSTANS, CONSTANS-LIKE, and TIMING OF CHLOROPHYLL A/B BINDING1)  domain protein, Heading date, Long-day repression, Regulator of growth, development, and stress-response
CAACTTGCCCTGTCTTCTTCTTCTTCTTCTTCTTGTACCTATATTATTACAAGTCATCGA
TCTCGCTGATCGATCAGTGATCACAAGCATTTCACAACCCTAGCTAGCTGAGCTGATCGA
GCTCAAGTGACCTCACCTGCTATAGCTAACTTACTAGCTAGCTCTAGCTAGTTGTTGTTT
GTAGCTCGATCGAGTTTGATTTATCCGTTCATGTCGATGGGACCAGCAGCCGGAGAAGGA
TGTGGCCTGTGCGGCGCCGACGGTGGCGGCTGTTGCTCCCGCCATCGCCACGATGATGAT
GGATTCCCCTTCGTCTTCCCGCCGAGTGCGTGCCAGGGGATCGGCGCCCCGGCGCCACCG
GTGCACGAGTTCCAGTTCTTCGGCAACGACGGCGGCGGCGACGACGGCGAGAGCGTGGCC
TGGCTGTTCGATGACTACCCGCCGCCGTCGCCCGTTGCTGCCGCCGCCGGGATGCATCAT
CGGCAGCCGCCGTACGACGGCGTCGTGGCGCCGCCGTCGCTGTTCAGGAGGAACACCGGC
GCCGGCGGGCTCACGTTCGACGTCTCCCTCGGCGAACGGCCCGACCTGGACGCCGGGCTC
GGCCTCGGCGGCGGCGGCGGCCGGCACGCCGAGGCCGCGGCCAGCGCCACCATCATGTCA
TATTGTGGGAGCACGTTCACTGACGCAGCGAGCTCGATGCCCAAGGAGATGGTGGCCGCC
ATGGCCGATGATGGGGAGAGCTTGAACCCAAACACGGTGGTTGGCGCAATGGTGGAGAGG
GAGGCCAAGCTGATGAGGTACAAGGAGAAGAGGAAGAAGAGGTGCTACGAGAAGCAAATC
CGGTACGCGTCCAGAAAAGCCTATGCCGAGATGAGGCCCCGAGTGAGAGGTCGCTTCGCC
AAAGAACCTGATCAGGAAGCTGTCGCACCGCCATCCACCTATGTCGATCCTAGTAGGCTT
GAGCTTGGACAATGGTTCAGATAGATAATTACAGTGCGTATATACCACT

CDS

774 bp

>Os07t0261200-01 CCT(CONSTANS, CONSTANS-LIKE, and TIMING OF CHLOROPHYLL A/B BINDING1)  domain protein, Heading date, Long-day repression, Regulator of growth, development, and stress-response
ATGTCGATGGGACCAGCAGCCGGAGAAGGATGTGGCCTGTGCGGCGCCGACGGTGGCGGC
TGTTGCTCCCGCCATCGCCACGATGATGATGGATTCCCCTTCGTCTTCCCGCCGAGTGCG
TGCCAGGGGATCGGCGCCCCGGCGCCACCGGTGCACGAGTTCCAGTTCTTCGGCAACGAC
GGCGGCGGCGACGACGGCGAGAGCGTGGCCTGGCTGTTCGATGACTACCCGCCGCCGTCG
CCCGTTGCTGCCGCCGCCGGGATGCATCATCGGCAGCCGCCGTACGACGGCGTCGTGGCG
CCGCCGTCGCTGTTCAGGAGGAACACCGGCGCCGGCGGGCTCACGTTCGACGTCTCCCTC
GGCGAACGGCCCGACCTGGACGCCGGGCTCGGCCTCGGCGGCGGCGGCGGCCGGCACGCC
GAGGCCGCGGCCAGCGCCACCATCATGTCATATTGTGGGAGCACGTTCACTGACGCAGCG
AGCTCGATGCCCAAGGAGATGGTGGCCGCCATGGCCGATGATGGGGAGAGCTTGAACCCA
AACACGGTGGTTGGCGCAATGGTGGAGAGGGAGGCCAAGCTGATGAGGTACAAGGAGAAG
AGGAAGAAGAGGTGCTACGAGAAGCAAATCCGGTACGCGTCCAGAAAAGCCTATGCCGAG
ATGAGGCCCCGAGTGAGAGGTCGCTTCGCCAAAGAACCTGATCAGGAAGCTGTCGCACCG
CCATCCACCTATGTCGATCCTAGTAGGCTTGAGCTTGGACAATGGTTCAGATAG

Protein

258 aa

>Os07t0261200-01 CCT(CONSTANS, CONSTANS-LIKE, and TIMING OF CHLOROPHYLL A/B BINDING1)  domain protein, Heading date, Long-day repression, Regulator of growth, development, and stress-response
MSMGPAAGEGCGLCGADGGGCCSRHRHDDDGFPFVFPPSACQGIGAPAPPVHEFQFFGND
GGGDDGESVAWLFDDYPPPSPVAAAAGMHHRQPPYDGVVAPPSLFRRNTGAGGLTFDVSL
GERPDLDAGLGLGGGGGRHAEAAASATIMSYCGSTFTDAASSMPKEMVAAMADDGESLNP
NTVVGAMVEREAKLMRYKEKRKKRCYEKQIRYASRKAYAEMRPRVRGRFAKEPDQEAVAP
PSTYVDPSRLELGQWFR*

5'UTR

chr07:9154821..9155030 (- strand) : 210 bp

CDS

chr07:9154377..9154820 (- strand) : 444 bp

chr07:9152402..9152731 (- strand) : 330 bp

3'UTR

chr07:9152377..9152401 (- strand) : 25 bp

FASTA

>Os07t0261200-01 class=Sequence position=chr07:9152377..9155030 (- strand)
CAACTTGCCC TGTCTTCTTC TTCTTCTTCT TCTTGTACCT ATATTATTAC AAGTCATCGA TCTCGCTGAT CGATCAGTGA
TCACAAGCAT TTCACAACCC TAGCTAGCTG AGCTGATCGA GCTCAAGTGA CCTCACCTGC TATAGCTAAC TTACTAGCTA
GCTCTAGCTA GTTGTTGTTT GTAGCTCGAT CGAGTTTGAT TTATCCGTTC ATGTCGATGG GACCAGCAGC CGGAGAAGGA
TGTGGCCTGT GCGGCGCCGA CGGTGGCGGC TGTTGCTCCC GCCATCGCCA CGATGATGAT GGATTCCCCT TCGTCTTCCC
GCCGAGTGCG TGCCAGGGGA TCGGCGCCCC GGCGCCACCG GTGCACGAGT TCCAGTTCTT CGGCAACGAC GGCGGCGGCG
ACGACGGCGA GAGCGTGGCC TGGCTGTTCG ATGACTACCC GCCGCCGTCG CCCGTTGCTG CCGCCGCCGG GATGCATCAT
CGGCAGCCGC CGTACGACGG CGTCGTGGCG CCGCCGTCGC TGTTCAGGAG GAACACCGGC GCCGGCGGGC TCACGTTCGA
CGTCTCCCTC GGCGAACGGC CCGACCTGGA CGCCGGGCTC GGCCTCGGCG GCGGCGGCGG CCGGCACGCC GAGGCCGCGG
CCAGCGCCAC CATCGTGAGT ATCAATCCAA TAATCCTGAT CCGGCCGGCA TGATCGGCTC GATTGAGCCG TGTCGATTAT
TAATTTCCAT CTTATATATT ATTAATTGAT GAATTCTTGA TTGATTCATC GATCCTCCTC GTCTTTTCTT GGCTTCTTTG
TTTTTGTTAT TTAGTCAAAA ACAACTCTTC ATTTCTGCTG CCTATATGCC GTACAACTTC aaactatcaa aggtcaaata
atcgatcaat atataccaag tttgaattaa tttggagctt aattaattaa ttACTGGCTT GCAGCAGCTG GTTTATAGTA
TTGTTTCTAG CTATATATGT GAGGGCCGTG TGTGGGATGT GATTTGCATC TTTCGATGGC GACTTAATTA ATTCGATGAT
ATATTTCATT GCATATGCAT ACGGATCCAG CCTCTGTCTA TACTGTACGA TTCCACATAC GTATATGTAC GGTTAAGTCA
GTATATATAC TTTTAGATAG TCGCGTGTGC TTTTCGAGTT CGGTAGCTAT ATTTTAGATT GTAAAAACAA GTCAGAGGCT
AATTTTATAA TCTAGAAATA CTTATTTCCC CATATATAAG CGTATGTTAA ATATTGATGG TGTAATCTAC TTATATGTCA
GGAAACATCA TTGCTTGCTT TCTGGCGCTT TCTTCTACAT ATCAGTAGAG GAAAATGGAA AAAAAAAGAT GAATTTTGAT
GTTGTAGTTT GCTATATTCA GCATATATAC CATCAGTTAT ACATATGCAG ATCTTGCTAA AACCAAAATA AAAATAGAAC
TGTAAGGAGA TATTGTGCTT CTCGGTCTAT TTACTTACAG TTTGTTGAGA AGTAATACGA GCAAGCAAAT GTATATATAT
ATTTCTTTAG AACTGCAAGG AGATGCATAT ACATGTGTGA TTCAAACACA CGTACTGCAC ATTCAAACTA TAAAAACAAC
TTGATTGCCG TAGAAGTTAA AAGGGAGACA TATCCATGGG TTTCGGATTC TAAATCAATC TATGTGTAAA TGAAACTTTA
GTATAGTAGG AAATAGGTTT TCAAAAAAAA AAGTATAGTA GGAAATAGTA TGTGTATATG CCTTTTTAAC CCTTAATTAC
AAGTTGTTAT AATTCAGTGT TAACAAAGTC ACGGACTCAC AGAGTGTGCC CTTACACAAT TTCAGACTAA TTTGTAAATG
CATCGATCGT CACATTTTAT GTGGTTCAAT TATCTGACAC AGTTAATTAA TGGTGGCCGA TCGATGTATG CTCTTCTAGC
TTTCCAGCTA TATGCGTATG TAATAAATGA ATAAAACGTG TAGGATGAAA TGTGAATACG CATCATTGTA ATTAATTTGA
TTAATGCTAG TAAAAAATCT GCAAATTTGT CTTTTTGAAA TTAAAATATG CCTTATAAAA TTAATGGACC CAGGCCCCTA
GGGCAAAATA TATTGGGGCA CAAAATCATG TCCATATATA CATTCTTATT TGAAAGTAGA CTCTGAAACA AAATATGCCC
ATATAAATCA AGGGAGGTTA CAACTAACTG CATTTGCTTA TGCGTACATC TGGATTGTAA CTTCTATGTT TTGTACATAC
GATGATTAAT TGTATTCGAG CTTCTTAATT GTACATCTAT TAACTAACTA GTTTTGCAGA TGTCATATTG TGGGAGCACG
TTCACTGACG CAGCGAGCTC GATGCCCAAG GAGATGGTGG CCGCCATGGC CGATGATGGG GAGAGCTTGA ACCCAAACAC
GGTGGTTGGC GCAATGGTGG AGAGGGAGGC CAAGCTGATG AGGTACAAGG AGAAGAGGAA GAAGAGGTGC TACGAGAAGC
AAATCCGGTA CGCGTCCAGA AAAGCCTATG CCGAGATGAG GCCCCGAGTG AGAGGTCGCT TCGCCAAAGA ACCTGATCAG
GAAGCTGTCG CACCGCCATC CACCTATGTC GATCCTAGTA GGCTTGAGCT TGGACAATGG TTCAGATAGA TAATTACAGT
GCGTATATAC CACT