Os07t0273700-00

Locus

Os07g0273700

Description

Disease resistance protein domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

WRKY123

CGSNL Gene Name

WRKY GENE 123

Oryzabase Gene Symbol Synonym(s)

OsWRKY123, DLN183, OsDLN183

Oryzabase Gene Name Synonym(s)

DLN repressor 183, DLN motif protein 183

Transcript Evidence

ab initio prediction

Protein Evidence

NP_001059355.2 (RefSeq)

Literature

Rice WRKY Working Group 2012. Rice 5:3.

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Biological Process: defense response (GO:0006952)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ADP binding (GO:0043531)

Functional domain (InterPro)

Disease resistance protein (IPR000767)

Leucine-rich repeat (IPR001611)

NB-ARC (IPR002182)

Transcriptional factor B3 (IPR003340)

DNA-binding pseudobarrel domain (IPR015300)

Expression Databases

TENOR (Os07t0273700-00)

Others

Oryzabase (9219)

Transcript

4020 bp

>Os07t0273700-00 Disease resistance protein domain containing protein.
ATGGAACCTGGAAGCAGCAGTAGGGAGGGGGAGCAGCAGGAGCCAGCAAACGAACGACTA
ACCGCCACCGGAGGAGGAGGAGGAGGAGGAGGAGGAAGCCCTGTCTCAGATCAGGAACTC
TCGGATGGTGAGGAAGTGTCTGATGGTGAGTATCAGGCCGGCGACGATTTCTCTGGCTAC
GCGGTCCGGGGCCGGGGGTTCGTCGAGAAGGAGCACATATTCGACAAGGTGGTGACGCCC
AGCGACGTCGGGAATCTGGGCCGGCTGGTGATCCCGTGGCAGCACGCGGAGTGCTACTTC
CCGCGGGACGTACCCGCGAACGAGAGGGAGGGCGTCGTCCTCAGATTCGAGGACGATGCC
GGCAATTCATGGCGTTTCCTCTACCGCGGCAGCAGCTTGACGTTGGGATGGAGCCACTTC
TTCAGGAAGAACCGCCTCGACGCCGGGGACATGGTCTCCTTCTACCGTGGCGCCAGCGAG
GCCACCCGTGACCGCCTCTTCATCCACTCGAAGCGCCGGATGCACATTCTCCCTACTCTA
GGCTACTCAGACCCTCAGGTTCATATCAATCGCCTCTTTCAGCTGCTGGTTCGGGTAAGA
ACCATGGTTTCATCCTTCGGTAAATCTGGGTCGCCGTCGCCGCCCAATTCTCCGCTTCCT
ACAGTTCAAAATTTCACCTACAAAGCGCTAAAAGATTGCCTCCAAGATCTGCACTACTAC
AGCCTCCTGTCCATGATGGGGAGAAACCACAAAAGTCAGTCAACATCCGCAAAGATCCGT
GATACTATTCCTACGCTTGATGCTTTGATACAATTACGAAGCCTGTCAGATCCAGTTTTT
CGTATTCCCGCCGCAGCGACGTCGCATTGCATCCTCTTATGCCGTGGTGTTTTGGGGATC
ATGGGCTTCCTATGCTCTGATGAGAATATGAAGGAGGATCACCGGATGCTTCAGGTTCCT
GCTTTTGATGATCTGAACTACTCTGCCCAAGACAAGATTACCAGGATGAAAGAACAGACA
ATGCCATCATCCCTGGCTGACCCCATTTATCTGTTGCCCACAGCAATCAGGAACCTGCTG
TATTTGGACCTCTCAAATTGCAGTGACATTGTACAACTGCCTCCTTCCCTGGGATCATCA
CTTCATATGCTCTCTGCACTAAACCTCTCTTGTTGTTATTCTCTTCGTGCGTTGCCGGAT
TCACTAGTATGCCTGTACGACTTGCAGATTCTGCTTCTTTCCTTCTGCCACAATCTGCAA
AACCTTCCGGTGTCATTTGGTGATCTTTCTAATCTCAGGCTGTTGGATTTGTCGGGCTGT
CGCAGTCTTAGATTGTTCCCTTCTTCTTTTGTCAATCTGGGCAGTCTAGAGAACTTGAAC
TTATCTGACTGTATAAGGCTGATGGGCATTCCACAGAATTTTGAAGATCTTCAGAAGCTC
GAGTACTTGAATTTTGCAGGATGCTACAGAGTGGACCTGCCTGTTTACTGCCTAACCAAC
CTTGTTAATCTGAAGTGCCTAACTCTGTCAAACCACACTGATATCAAAGATTTTCCTTAT
TCCTTCACTGATCTTAAAAGACATCTATACCTGTCAAGATGGTGGAAATACAACTGGGTA
CATACCCAATGCAACCTAAAGTCCTATAGGTGTCACCAGCAAAGAATAATTAACAGCTTA
CTGTCAGATGGTTCTGATGAGGGTGACATTACTAGTGAGCAGAGTCTCACATCTATCTGT
ATATTTGGTGAAAGAGGCACAGGGAAGACTGAGCTACTCCATGAAATTTATAATGATCAA
AAAATTTTAGAGGGTTTTCATCTGAGGATATGGATAAATATGTGTGACAAAAAGAGGCTA
TTGGAGAAGATCATAGAGTTTACAGCTTGTGCCTATTGCTATGATGCCCCATCAAGCATT
CTTGAAGAAACTGTAAGAGAAGAGCTTAATGGCAAGAGATTCTTACTTGTACTGAATGAT
GCTGATATTGAAAACCAATGTTTCTGGACAGATGTATGGAAGGTATCAAATGTTGGTGCC
GCAGGAAGTGCTCTTATTGTAACCACAAGGAGCAAAGAAGTGGCTAGCCTATTTGGAGCA
ATGAAACCCTATTACATGAATCCCCTATCTAAAGAAGAATGCTTTATGGTCTTCCAGGAA
CATGCTGATTGTGGTTTTGATATTAATAATGACCATGAGTTAACAAAAGTTGGCTGGAAG
ATTGTTGAGAAATGTGGTGGTAATCTATTGTGTATGAAGGCTCTAAGCGGGTTATTATGG
CATTCTAAAACTGCTTTGTCTGAAATCGATTCGCTTGTTGGCGGTATTGTACCAGCACTA
AGACTCTGTTATGATCTTCTACCGTCACATCTGAAGCAGTGCTTCAAATTCTGTTCCCTG
TTTCCAAAAGACTATGTTTTCGTCAAGCATCACATCATCCAATTATGGATCTCTCAAGGT
TTTGTATACCCTGAAGAAGATAGTCAACCAGAAGACACTGGCCTGCAGTATTTTAATGAG
TTTCTCTGCAGATCATTTTTCCAACACTGCCCCTTTAGTAATGATCATGAAGACAAATTC
GTTATGCATGAGTTATTTCATGATTTGGCACGTTCCGTTTCAAAGGATGAAAGCTTCAGT
TCAGAGGAACCATTTTTCAGCCTTCCTGAAAATATTTGCCACCTTTCACTTGTTATTTCA
GATTCCAATACTGTTGTGTTGACAAAAGAACATAGACATCTGCAGTCCCTTATGGTTGTC
AGGAGATCAGCAACAGAGTACTCAAGTTCCTTTGTGCCACTTTTGAAAATATTGGGTTTG
AATGATCTTCTGATGAAATGTGGATTTTTAAGAGCATTGAATTTGAGCTGTACAACAATA
GTAGACCTGCCTGGTTCAATTGGGAGGATGAAACACTTAAGATTCCTGGCTATGAACAAC
ACAAAGATCAAGAGTCTACCAACTGAAATAGGTCAATTGAACACCCTTCAGACATTGGAA
CTCAAGGATTGTTGCTGCCTCATTGAGTTACCGGAAAGCACGAAGAATTTGATGAAGCTG
CGACACCTTGATGTTCAAAAGGAACCAGGAAATATTCATGTTGGCATGCCTTCTGGGCTC
GGGCAGCTAACTGATCTACAAACACTAACGGTATTTAATATTGGGGATGATTTATCACAT
TGTTCAATTCGGGACTTGAAGAATCTCAGTGGACTAAGGGGACATGTTCATATAACAGGG
CTTCAAAATATTACTGCAGGTGATGATGCCAAAGAAGCAAATCTAGTAGGTAAGCAATTC
CTACAAGCTTTGACACTAGAATGGTGTTGCAGCAGTGAGGAAATGGAAGATGAAAGTGAC
AAAGAAATTGCTAATCAGGTCCTTCAAAATCTTCAGCCAAACACTAGCATTCAAGAGCTA
GCTATTCAAAATTATCCTGGCAATTCGTTCCCTAATTGGATTAAGGATTCAGGGCTTTGC
ATGCTTGTTTCAATTACAATTGACAACTCGCAAGACTGTAATGAGATCCCGTACCTTGGT
GACCTGCCATGTCTTAAATTTCTCTTCATACAGAAAATGTATGCTGTAGAAAACTTTGGA
CAAAGAAGTAACTCTTTGACTACTGATGGTAAACATGCCCCTGGATTCCCATCACTGGAG
ATACTGAATCTGTGGGAGATGTATTCTTTGCAATTCTGGAATGGAACAAGATATGGGGAT
TTCCCACAGCTTCGAGGTCTCTCTATCAGTAGATGCCCAAAACTCAGTAATTTACCACCC
CTGATTTCCCTGCTATATTTGTCATTTCACTGTGGTGATCAACTGCCAGCCTTGTCAGAA
TTTCCATCACTCAAGTCACTGAAGATTGAAGGCTTTCAGAAGCTCAAGTCTGTCAGCTTC
TGCCCTGAGATGCCATTGTTACAAAAATTGGAGATAAGTGATTGCAAAGATTGTCAGGTG
CCCAAAACTTCATTTTGGAGGCAGTTGGCTCGAAGGCTGTCTCATGTGGGAAGAGTTTAA

CDS

4020 bp

>Os07t0273700-00 Disease resistance protein domain containing protein.
ATGGAACCTGGAAGCAGCAGTAGGGAGGGGGAGCAGCAGGAGCCAGCAAACGAACGACTA
ACCGCCACCGGAGGAGGAGGAGGAGGAGGAGGAGGAAGCCCTGTCTCAGATCAGGAACTC
TCGGATGGTGAGGAAGTGTCTGATGGTGAGTATCAGGCCGGCGACGATTTCTCTGGCTAC
GCGGTCCGGGGCCGGGGGTTCGTCGAGAAGGAGCACATATTCGACAAGGTGGTGACGCCC
AGCGACGTCGGGAATCTGGGCCGGCTGGTGATCCCGTGGCAGCACGCGGAGTGCTACTTC
CCGCGGGACGTACCCGCGAACGAGAGGGAGGGCGTCGTCCTCAGATTCGAGGACGATGCC
GGCAATTCATGGCGTTTCCTCTACCGCGGCAGCAGCTTGACGTTGGGATGGAGCCACTTC
TTCAGGAAGAACCGCCTCGACGCCGGGGACATGGTCTCCTTCTACCGTGGCGCCAGCGAG
GCCACCCGTGACCGCCTCTTCATCCACTCGAAGCGCCGGATGCACATTCTCCCTACTCTA
GGCTACTCAGACCCTCAGGTTCATATCAATCGCCTCTTTCAGCTGCTGGTTCGGGTAAGA
ACCATGGTTTCATCCTTCGGTAAATCTGGGTCGCCGTCGCCGCCCAATTCTCCGCTTCCT
ACAGTTCAAAATTTCACCTACAAAGCGCTAAAAGATTGCCTCCAAGATCTGCACTACTAC
AGCCTCCTGTCCATGATGGGGAGAAACCACAAAAGTCAGTCAACATCCGCAAAGATCCGT
GATACTATTCCTACGCTTGATGCTTTGATACAATTACGAAGCCTGTCAGATCCAGTTTTT
CGTATTCCCGCCGCAGCGACGTCGCATTGCATCCTCTTATGCCGTGGTGTTTTGGGGATC
ATGGGCTTCCTATGCTCTGATGAGAATATGAAGGAGGATCACCGGATGCTTCAGGTTCCT
GCTTTTGATGATCTGAACTACTCTGCCCAAGACAAGATTACCAGGATGAAAGAACAGACA
ATGCCATCATCCCTGGCTGACCCCATTTATCTGTTGCCCACAGCAATCAGGAACCTGCTG
TATTTGGACCTCTCAAATTGCAGTGACATTGTACAACTGCCTCCTTCCCTGGGATCATCA
CTTCATATGCTCTCTGCACTAAACCTCTCTTGTTGTTATTCTCTTCGTGCGTTGCCGGAT
TCACTAGTATGCCTGTACGACTTGCAGATTCTGCTTCTTTCCTTCTGCCACAATCTGCAA
AACCTTCCGGTGTCATTTGGTGATCTTTCTAATCTCAGGCTGTTGGATTTGTCGGGCTGT
CGCAGTCTTAGATTGTTCCCTTCTTCTTTTGTCAATCTGGGCAGTCTAGAGAACTTGAAC
TTATCTGACTGTATAAGGCTGATGGGCATTCCACAGAATTTTGAAGATCTTCAGAAGCTC
GAGTACTTGAATTTTGCAGGATGCTACAGAGTGGACCTGCCTGTTTACTGCCTAACCAAC
CTTGTTAATCTGAAGTGCCTAACTCTGTCAAACCACACTGATATCAAAGATTTTCCTTAT
TCCTTCACTGATCTTAAAAGACATCTATACCTGTCAAGATGGTGGAAATACAACTGGGTA
CATACCCAATGCAACCTAAAGTCCTATAGGTGTCACCAGCAAAGAATAATTAACAGCTTA
CTGTCAGATGGTTCTGATGAGGGTGACATTACTAGTGAGCAGAGTCTCACATCTATCTGT
ATATTTGGTGAAAGAGGCACAGGGAAGACTGAGCTACTCCATGAAATTTATAATGATCAA
AAAATTTTAGAGGGTTTTCATCTGAGGATATGGATAAATATGTGTGACAAAAAGAGGCTA
TTGGAGAAGATCATAGAGTTTACAGCTTGTGCCTATTGCTATGATGCCCCATCAAGCATT
CTTGAAGAAACTGTAAGAGAAGAGCTTAATGGCAAGAGATTCTTACTTGTACTGAATGAT
GCTGATATTGAAAACCAATGTTTCTGGACAGATGTATGGAAGGTATCAAATGTTGGTGCC
GCAGGAAGTGCTCTTATTGTAACCACAAGGAGCAAAGAAGTGGCTAGCCTATTTGGAGCA
ATGAAACCCTATTACATGAATCCCCTATCTAAAGAAGAATGCTTTATGGTCTTCCAGGAA
CATGCTGATTGTGGTTTTGATATTAATAATGACCATGAGTTAACAAAAGTTGGCTGGAAG
ATTGTTGAGAAATGTGGTGGTAATCTATTGTGTATGAAGGCTCTAAGCGGGTTATTATGG
CATTCTAAAACTGCTTTGTCTGAAATCGATTCGCTTGTTGGCGGTATTGTACCAGCACTA
AGACTCTGTTATGATCTTCTACCGTCACATCTGAAGCAGTGCTTCAAATTCTGTTCCCTG
TTTCCAAAAGACTATGTTTTCGTCAAGCATCACATCATCCAATTATGGATCTCTCAAGGT
TTTGTATACCCTGAAGAAGATAGTCAACCAGAAGACACTGGCCTGCAGTATTTTAATGAG
TTTCTCTGCAGATCATTTTTCCAACACTGCCCCTTTAGTAATGATCATGAAGACAAATTC
GTTATGCATGAGTTATTTCATGATTTGGCACGTTCCGTTTCAAAGGATGAAAGCTTCAGT
TCAGAGGAACCATTTTTCAGCCTTCCTGAAAATATTTGCCACCTTTCACTTGTTATTTCA
GATTCCAATACTGTTGTGTTGACAAAAGAACATAGACATCTGCAGTCCCTTATGGTTGTC
AGGAGATCAGCAACAGAGTACTCAAGTTCCTTTGTGCCACTTTTGAAAATATTGGGTTTG
AATGATCTTCTGATGAAATGTGGATTTTTAAGAGCATTGAATTTGAGCTGTACAACAATA
GTAGACCTGCCTGGTTCAATTGGGAGGATGAAACACTTAAGATTCCTGGCTATGAACAAC
ACAAAGATCAAGAGTCTACCAACTGAAATAGGTCAATTGAACACCCTTCAGACATTGGAA
CTCAAGGATTGTTGCTGCCTCATTGAGTTACCGGAAAGCACGAAGAATTTGATGAAGCTG
CGACACCTTGATGTTCAAAAGGAACCAGGAAATATTCATGTTGGCATGCCTTCTGGGCTC
GGGCAGCTAACTGATCTACAAACACTAACGGTATTTAATATTGGGGATGATTTATCACAT
TGTTCAATTCGGGACTTGAAGAATCTCAGTGGACTAAGGGGACATGTTCATATAACAGGG
CTTCAAAATATTACTGCAGGTGATGATGCCAAAGAAGCAAATCTAGTAGGTAAGCAATTC
CTACAAGCTTTGACACTAGAATGGTGTTGCAGCAGTGAGGAAATGGAAGATGAAAGTGAC
AAAGAAATTGCTAATCAGGTCCTTCAAAATCTTCAGCCAAACACTAGCATTCAAGAGCTA
GCTATTCAAAATTATCCTGGCAATTCGTTCCCTAATTGGATTAAGGATTCAGGGCTTTGC
ATGCTTGTTTCAATTACAATTGACAACTCGCAAGACTGTAATGAGATCCCGTACCTTGGT
GACCTGCCATGTCTTAAATTTCTCTTCATACAGAAAATGTATGCTGTAGAAAACTTTGGA
CAAAGAAGTAACTCTTTGACTACTGATGGTAAACATGCCCCTGGATTCCCATCACTGGAG
ATACTGAATCTGTGGGAGATGTATTCTTTGCAATTCTGGAATGGAACAAGATATGGGGAT
TTCCCACAGCTTCGAGGTCTCTCTATCAGTAGATGCCCAAAACTCAGTAATTTACCACCC
CTGATTTCCCTGCTATATTTGTCATTTCACTGTGGTGATCAACTGCCAGCCTTGTCAGAA
TTTCCATCACTCAAGTCACTGAAGATTGAAGGCTTTCAGAAGCTCAAGTCTGTCAGCTTC
TGCCCTGAGATGCCATTGTTACAAAAATTGGAGATAAGTGATTGCAAAGATTGTCAGGTG
CCCAAAACTTCATTTTGGAGGCAGTTGGCTCGAAGGCTGTCTCATGTGGGAAGAGTTTAA

Protein

1340 aa

>Os07t0273700-00 Disease resistance protein domain containing protein.
MEPGSSSREGEQQEPANERLTATGGGGGGGGGSPVSDQELSDGEEVSDGEYQAGDDFSGY
AVRGRGFVEKEHIFDKVVTPSDVGNLGRLVIPWQHAECYFPRDVPANEREGVVLRFEDDA
GNSWRFLYRGSSLTLGWSHFFRKNRLDAGDMVSFYRGASEATRDRLFIHSKRRMHILPTL
GYSDPQVHINRLFQLLVRVRTMVSSFGKSGSPSPPNSPLPTVQNFTYKALKDCLQDLHYY
SLLSMMGRNHKSQSTSAKIRDTIPTLDALIQLRSLSDPVFRIPAAATSHCILLCRGVLGI
MGFLCSDENMKEDHRMLQVPAFDDLNYSAQDKITRMKEQTMPSSLADPIYLLPTAIRNLL
YLDLSNCSDIVQLPPSLGSSLHMLSALNLSCCYSLRALPDSLVCLYDLQILLLSFCHNLQ
NLPVSFGDLSNLRLLDLSGCRSLRLFPSSFVNLGSLENLNLSDCIRLMGIPQNFEDLQKL
EYLNFAGCYRVDLPVYCLTNLVNLKCLTLSNHTDIKDFPYSFTDLKRHLYLSRWWKYNWV
HTQCNLKSYRCHQQRIINSLLSDGSDEGDITSEQSLTSICIFGERGTGKTELLHEIYNDQ
KILEGFHLRIWINMCDKKRLLEKIIEFTACAYCYDAPSSILEETVREELNGKRFLLVLND
ADIENQCFWTDVWKVSNVGAAGSALIVTTRSKEVASLFGAMKPYYMNPLSKEECFMVFQE
HADCGFDINNDHELTKVGWKIVEKCGGNLLCMKALSGLLWHSKTALSEIDSLVGGIVPAL
RLCYDLLPSHLKQCFKFCSLFPKDYVFVKHHIIQLWISQGFVYPEEDSQPEDTGLQYFNE
FLCRSFFQHCPFSNDHEDKFVMHELFHDLARSVSKDESFSSEEPFFSLPENICHLSLVIS
DSNTVVLTKEHRHLQSLMVVRRSATEYSSSFVPLLKILGLNDLLMKCGFLRALNLSCTTI
VDLPGSIGRMKHLRFLAMNNTKIKSLPTEIGQLNTLQTLELKDCCCLIELPESTKNLMKL
RHLDVQKEPGNIHVGMPSGLGQLTDLQTLTVFNIGDDLSHCSIRDLKNLSGLRGHVHITG
LQNITAGDDAKEANLVGKQFLQALTLEWCCSSEEMEDESDKEIANQVLQNLQPNTSIQEL
AIQNYPGNSFPNWIKDSGLCMLVSITIDNSQDCNEIPYLGDLPCLKFLFIQKMYAVENFG
QRSNSLTTDGKHAPGFPSLEILNLWEMYSLQFWNGTRYGDFPQLRGLSISRCPKLSNLPP
LISLLYLSFHCGDQLPALSEFPSLKSLKIEGFQKLKSVSFCPEMPLLQKLEISDCKDCQV
PKTSFWRQLARRLSHVGRV*

CDS

chr07:10158135..10159775 (- strand) : 1641 bp

chr07:10155576..10157884 (- strand) : 2309 bp

chr07:10155459..10155528 (- strand) : 70 bp

FASTA

>Os07t0273700-00 class=Sequence position=chr07:10155459..10159775 (- strand)
ATGGAACCTG GAAGCAGCAG TAGGGAGGGG GAGCAGCAGG AGCCAGCAAA CGAACGACTA ACCGCCACCG GAGGAGGAGG
AGGAGGAGGA GGAGGAAGCC CTGTCTCAGA TCAGGAACTC TCGGATGGTG AGGAAGTGTC TGATGGTGAG TATCAGGCCG
GCGACGATTT CTCTGGCTAC GCGGTCCGGG GCCGGGGGTT CGTCGAGAAG GAGCACATAT TCGACAAGGT GGTGACGCCC
AGCGACGTCG GGAATCTGGG CCGGCTGGTG ATCCCGTGGC AGCACGCGGA GTGCTACTTC CCGCGGGACG TACCCGCGAA
CGAGAGGGAG GGCGTCGTCC TCAGATTCGA GGACGATGCC GGCAATTCAT GGCGTTTCCT CTACCGCGGC AGCAGCTTGA
CGTTGGGATG GAGCCACTTC TTCAGGAAGA ACCGCCTCGA CGCCGGGGAC ATGGTCTCCT TCTACCGTGG CGCCAGCGAG
GCCACCCGTG ACCGCCTCTT CATCCACTCG AAGCGCCGGA TGCACATTCT CCCTACTCTA GGCTACTCAG ACCCTCAGGT
TCATATCAAT CGCCTCTTTC AGCTGCTGGT TCGGGTAAGA ACCATGGTTT CATCCTTCGG TAAATCTGGG TCGCCGTCGC
CGCCCAATTC TCCGCTTCCT ACAGTTCAAA ATTTCACCTA CAAAGCGCTA AAAGATTGCC TCCAAGATCT GCACTACTAC
AGCCTCCTGT CCATGATGGG GAGAAACCAC AAAAGTCAGT CAACATCCGC AAAGATCCGT GATACTATTC CTACGCTTGA
TGCTTTGATA CAATTACGAA GCCTGTCAGA TCCAGTTTTT CGTATTCCCG CCGCAGCGAC GTCGCATTGC ATCCTCTTAT
GCCGTGGTGT TTTGGGGATC ATGGGCTTCC TATGCTCTGA TGAGAATATG AAGGAGGATC ACCGGATGCT TCAGGTTCCT
GCTTTTGATG ATCTGAACTA CTCTGCCCAA GACAAGATTA CCAGGATGAA AGAACAGACA ATGCCATCAT CCCTGGCTGA
CCCCATTTAT CTGTTGCCCA CAGCAATCAG GAACCTGCTG TATTTGGACC TCTCAAATTG CAGTGACATT GTACAACTGC
CTCCTTCCCT GGGATCATCA CTTCATATGC TCTCTGCACT AAACCTCTCT TGTTGTTATT CTCTTCGTGC GTTGCCGGAT
TCACTAGTAT GCCTGTACGA CTTGCAGATT CTGCTTCTTT CCTTCTGCCA CAATCTGCAA AACCTTCCGG TGTCATTTGG
TGATCTTTCT AATCTCAGGC TGTTGGATTT GTCGGGCTGT CGCAGTCTTA GATTGTTCCC TTCTTCTTTT GTCAATCTGG
GCAGTCTAGA GAACTTGAAC TTATCTGACT GTATAAGGCT GATGGGCATT CCACAGAATT TTGAAGATCT TCAGAAGCTC
GAGTACTTGA ATTTTGCAGG ATGCTACAGA GTGGACCTGC CTGTTTACTG CCTAACCAAC CTTGTTAATC TGAAGTGCCT
AACTCTGTCA AACCACACTG ATATCAAAGA TTTTCCTTAT TCCTTCACTG ATCTTAAAAG ACATCTATAC CTGTCAAGAT
GGTGGAAATA CAACTGGGTA CATACCCAAT GCAACCTAAA GGTATGCTGC TTCTCTTTTT TCTTAAGCTT CAGATCAAGT
GTTTTTTAAC AGGCTCAAAC CTTTGCAAAC GTACTCTAAA TGTGCAATGT CATTAGTGGA GCAGTGCTTG TTTTATACCA
TGCCTTTAAT ACTCTTTTAA GTGTGAAATC TTCTTACTCC AGAAGCTAGT TTTAGTTTAT AATCTGTTGA TTTTCCTTTT
AAAAAAAGAT CTAACGTGTA AACATCAACC AAACAGACAA ATCTTTTGCA GTCCTATAGG TGTCACCAGC AAAGAATAAT
TAACAGCTTA CTGTCAGATG GTTCTGATGA GGGTGACATT ACTAGTGAGC AGAGTCTCAC ATCTATCTGT ATATTTGGTG
AAAGAGGCAC AGGGAAGACT GAGCTACTCC ATGAAATTTA TAATGATCAA AAAATTTTAG AGGGTTTTCA TCTGAGGATA
TGGATAAATA TGTGTGACAA AAAGAGGCTA TTGGAGAAGA TCATAGAGTT TACAGCTTGT GCCTATTGCT ATGATGCCCC
ATCAAGCATT CTTGAAGAAA CTGTAAGAGA AGAGCTTAAT GGCAAGAGAT TCTTACTTGT ACTGAATGAT GCTGATATTG
AAAACCAATG TTTCTGGACA GATGTATGGA AGGTATCAAA TGTTGGTGCC GCAGGAAGTG CTCTTATTGT AACCACAAGG
AGCAAAGAAG TGGCTAGCCT ATTTGGAGCA ATGAAACCCT ATTACATGAA TCCCCTATCT AAAGAAGAAT GCTTTATGGT
CTTCCAGGAA CATGCTGATT GTGGTTTTGA TATTAATAAT GACCATGAGT TAACAAAAGT TGGCTGGAAG ATTGTTGAGA
AATGTGGTGG TAATCTATTG TGTATGAAGG CTCTAAGCGG GTTATTATGG CATTCTAAAA CTGCTTTGTC TGAAATCGAT
TCGCTTGTTG GCGGTATTGT ACCAGCACTA AGACTCTGTT ATGATCTTCT ACCGTCACAT CTGAAGCAGT GCTTCAAATT
CTGTTCCCTG TTTCCAAAAG ACTATGTTTT CGTCAAGCAT CACATCATCC AATTATGGAT CTCTCAAGGT TTTGTATACC
CTGAAGAAGA TAGTCAACCA GAAGACACTG GCCTGCAGTA TTTTAATGAG TTTCTCTGCA GATCATTTTT CCAACACTGC
CCCTTTAGTA ATGATCATGA AGACAAATTC GTTATGCATG AGTTATTTCA TGATTTGGCA CGTTCCGTTT CAAAGGATGA
AAGCTTCAGT TCAGAGGAAC CATTTTTCAG CCTTCCTGAA AATATTTGCC ACCTTTCACT TGTTATTTCA GATTCCAATA
CTGTTGTGTT GACAAAAGAA CATAGACATC TGCAGTCCCT TATGGTTGTC AGGAGATCAG CAACAGAGTA CTCAAGTTCC
TTTGTGCCAC TTTTGAAAAT ATTGGGTTTG AATGATCTTC TGATGAAATG TGGATTTTTA AGAGCATTGA ATTTGAGCTG
TACAACAATA GTAGACCTGC CTGGTTCAAT TGGGAGGATG AAACACTTAA GATTCCTGGC TATGAACAAC ACAAAGATCA
AGAGTCTACC AACTGAAATA GGTCAATTGA ACACCCTTCA GACATTGGAA CTCAAGGATT GTTGCTGCCT CATTGAGTTA
CCGGAAAGCA CGAAGAATTT GATGAAGCTG CGACACCTTG ATGTTCAAAA GGAACCAGGA AATATTCATG TTGGCATGCC
TTCTGGGCTC GGGCAGCTAA CTGATCTACA AACACTAACG GTATTTAATA TTGGGGATGA TTTATCACAT TGTTCAATTC
GGGACTTGAA GAATCTCAGT GGACTAAGGG GACATGTTCA TATAACAGGG CTTCAAAATA TTACTGCAGG TGATGATGCC
AAAGAAGCAA ATCTAGTAGG TAAGCAATTC CTACAAGCTT TGACACTAGA ATGGTGTTGC AGCAGTGAGG AAATGGAAGA
TGAAAGTGAC AAAGAAATTG CTAATCAGGT CCTTCAAAAT CTTCAGCCAA ACACTAGCAT TCAAGAGCTA GCTATTCAAA
ATTATCCTGG CAATTCGTTC CCTAATTGGA TTAAGGATTC AGGGCTTTGC ATGCTTGTTT CAATTACAAT TGACAACTCG
CAAGACTGTA ATGAGATCCC GTACCTTGGT GACCTGCCAT GTCTTAAATT TCTCTTCATA CAGAAAATGT ATGCTGTAGA
AAACTTTGGA CAAAGAAGTA ACTCTTTGAC TACTGATGGT AAACATGCCC CTGGATTCCC ATCACTGGAG ATACTGAATC
TGTGGGAGAT GTATTCTTTG CAATTCTGGA ATGGAACAAG ATATGGGGAT TTCCCACAGC TTCGAGGTCT CTCTATCAGT
AGATGCCCAA AACTCAGTAA TTTACCACCC CTGATTTCCC TGCTATATTT GTCATTTCAC TGTGGTGATC AACTGCCAGC
CTTGTCAGAA TTTCCATCAC TCAAGTCACT GAAGATTGAA GGCTTTCAGA AGCTCAAGTC TGTCAGCTTC TGCCCTGAGA
TGCCATTGTT ACAAAAATTG GAGATAAGTG ATTGCAAAGA GTTAGTATCA ATAGATGCTC CTTTGTTGTC TGTTTCAAAT
TTAAAAGTTG TCAGGTGCCC AAAACTTCAT TTTGGAGGCA GTTGGCTCGA AGGCTGTCTC ATGTGGGAAG AGTTTAA

Locus: Os07g0273700

Loading...

Locus: Os07g0273700

Loading...