Os07t0300200-01

Locus

Os07g0300200

Description

Pentatricopeptide repeat domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPILS5, PILS5

Oryzabase Gene Name Synonym(s)

PIN likes 5

Transcript Evidence

AK120733 (DDBJ, Best hit)

Protein Evidence

B8AKZ5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: binding (GO:0005488)

Functional domain (InterPro)

Pentatricopeptide repeat (IPR002885)

Tetratricopeptide-like helical (IPR011990)

Full-length cDNA

J023003D10 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0300200-01)

RiceXPro (AK120733)

Others

Oryzabase (19847)

KEGG (Os07t0300200-01)

Transcript

3206 bp

>Os07t0300200-01 Pentatricopeptide repeat domain containing protein.
ACAGAAGATCCCGTTCCCGTGCTCTGTTGCCAATTCTCCCCCACCACCATGCTCCTCGCC
GCGCGCGGCCGCCGTCACCCCTTCGCCGCCGCGCGCCTCCTTCCGATCCCGCTTTCCTCC
GGCCCCTCCTTCGCCTCCTCCACCACCACCACGACCTCCAATGGCGCCTGTTCGTCCTCC
GCCGCGGACCCCGACGCCGTGGCCGCCGAGGTGGCCACCCTCCTCTCCCGCTGCTCCGGC
GACTGGAGGCTCGCCGTCTCCTCCTCCGACCTCCCCTCCCGCCTCTCCCCCGCCGCCATC
TCCTCCCTCGTCCGACGACGCCCGTCCCCCTCCTCCCCGCGCCTCCACCCTAAGCTCCTC
CTCGACTTCTTCTACTGGTCCAGCCCCCAGCTCGCGCCGTCGGCCCCCGCCCCCGATGCC
TTCGCCCACCTGGCCATGTCCCTGTGCGCCGGCTCACTCTTCAACCTGGCCAACGGCCTC
CTCATCAAGATGATCCGCGCCTACCCGTCACCTCCCGTCGTCCTCGCCTCCATCCATCGC
GCGCTATCGGATTCTGGCCACCGTTCGCCGGCGGTGCTCGACGTCCTCGTGGATACCTAC
AAGAAGTCTGGGAGGGTGCAGGACGCCGCGGAGGTCGTCCTGATGATGAGAGATCGGGGC
ATGGCTCCCAGCATTCGGTGCTGCAACGCGCTGTTGAAGGATCTGCTGCGCGCGGACGCC
ATGGCTCTGCTTTGGAAGGTGCGAGAGTTCATGGTTGGCGCTGGGATTTCCCCGGATGTG
TATACGTACTCGACTCTGATCGAAGCCTACTGCAAGGTCCGGGAATTTGATACTGCCAAG
AAGGTGCTTGTGGAAATGCGTGAGAGGGGGTGCGGCCTGAACACCGTAACCTACAATGTG
CTGATTGCTGGGTTATGCAGGTCTGGGGCTGTCGAAGAGGCGTTTGGGTTCAAGAAGGAC
ATGGAGGATTATGGACTAGTTCCTGACGGGTTTACCTATGGCGCACTCATTAATGGACTG
TGCAAGAGCCGTAGGTCAAATGAGGCGAAGGCATTGTTGGACGAGATGTCTTGTGCTGAG
CTAAAGCCTAATGTCGTAGTTTATGCCAATCTGATTGATGGGTTTATGAGGGAGGGCAAT
GCAGATGAGGCGTTTAAGATGATAAAGGAGATGGTTGCTGCTGGTGTGCAGCCAAACAAA
ATTACCTATGACAATCTTGTTCGGGGACTATGTAAGATGGGGCAGATGGACAGGGCTTCT
CTACTTTTGAAGCAAATGGTCAGAGATAGCCATAGGCCTGATACCATCACGTACAATCTC
ATTATTGAAGGACATTTCCGTCATCATAGCAAAAAGGATGCTTTTCGGCTTCTTAGTGAA
ATGGAGAATGCTGGTATTTCCCCTAATGTATATACTTATAGCATAATGATTCATGGGCTA
TGCCAAAGTGGTGAACCAGAAAAGGCAAGTGATCTCCTTGAGGAAATGACTACAAAAGGA
TTGAAGCCTAATGCATTTGTTTATGCGCCTCTTATCTCAGGGTACTGTAGAGAAGGTAAT
GTTTCATTGGCATGTGAAATTTTTGATAAGATGACAAAGGTGAATGTACTCCCTGATTTG
TACTGCTACAATTCTCTTATATTTGGACTATCTAAGGTGGGAAGGGTGGAGGAATCTACA
AAGTACTTTGCTCAGATGCAGGAGAGAGGATTGCTGCCAAATGAATTCACATACAGTGGC
CTCATTCATGGGTATCTAAAGAATGGTGATCTAGAAAGTGCTGAACAGTTAGTGCAGCGG
ATGCTTGACACTGGACTAAAACCAAATGATGTTATCTACATTGATCTCCTAGAAAGCTAC
TTTAAGTCAGATGATATTGAAAAGGTGTCCTCTACTTTCAAGTCCATGTTAGACCAGGGA
GTTATGCTTGACAACCGTATCTATGGAATCTTGATTCATAATCTGTCCAGTTCTGGAAAT
ATGGAAGCAGCATTTAGGGTTCTTTCAGGGATTGAGAAGAATGGATCTGTTCCGGATGTG
CATGTGTACAGCTCGTTGATATCAGGTCTTTGCAAGACAGCTGACAGGGAAAAAGCTTTT
GGTATTCTTGATGAAATGTCTAAGAAGGGAGTAGATCCTAATATTGTATGCTATAATGCC
CTAATTGATGGGCTGTGCAAGTCTGGTGATATTTCTTATGCCCGCAATGTCTTCAATAGC
ATATTAGCTAAGGGATTAGTGCCAAACTGTGTGACATACACAAGTTTGATTGATGGAAGC
TGCAAAGTTGGTGACATCAGCAATGCATTCTATCTTTATAATGAAATGCTAGCAACAGGT
ATAACACCAGATGCTTTTGTCTATAGTGTACTTACCACTGGCTGCTCTAGTGCTGGTGAC
CTTGAGCAGGCAATGTTTCTGATTGAGGAAATGTTTCTTAGGGGACATGCAAGTATTTCT
TCTTTCAATAATTTAGTTGATGGTTTCTGCAAACGTGGAAAGATGCAGGAAACTTTGAAG
TTGTTGCATGTGATAATGGGCAGGGGCCTAGTACCTAATGCCCTGACTATTGAAAACATC
ATCAGTGGACTTAGTGAGGCTGGAAAACTCAGTGAAGTGCACACAATTTTTGTTGAGTTG
CAGCAGAAAACTTCAGAAAGCGCTGCCCGCCACTTTTCCTCATTGTTTATGGACATGATA
AATCAAGGAAAAATTCCTCTTGATGTGGTTGATGACATGATTCGAGATCATTGTAAAGAA
GGAAATCTGGACAAGGCTTTAATGCTGCGAGATGTTATTGTTGCGAAAAGTGCACCAATG
GGCTGCTCGTCCTATCTTGCTATAGTGGACAATCTATGCCGGAAGGGAAAATTAAGTGAA
GCGTTGAATTTGCTGAAAGAAATGGACAAGAGAGGTATTTGTCCCAGTGAGAATCAATGC
TTGATACTATTAACTAATCTTCATACATCTGGATATATCCAAGAACACAATACGGTACTT
GATAATATGTTGTGTCACAAGTGGTTACAGAAGGACAGCAAATTCTGTAATTCAGCTGGT
GATAATCTGGAATCTGTCAATGCAGAATAAACATAGAGCAGAATCCTTCCTATAAAAGAA
AGTCTGATTCTATTATTCATGTTGCGAATGCATGTCGTAGCCTTGTTTTTGTTTATTGAT
GAGGAATTAAACAGATTAATTTTTTC

CDS

3042 bp

>Os07t0300200-01 Pentatricopeptide repeat domain containing protein.
ATGCTCCTCGCCGCGCGCGGCCGCCGTCACCCCTTCGCCGCCGCGCGCCTCCTTCCGATC
CCGCTTTCCTCCGGCCCCTCCTTCGCCTCCTCCACCACCACCACGACCTCCAATGGCGCC
TGTTCGTCCTCCGCCGCGGACCCCGACGCCGTGGCCGCCGAGGTGGCCACCCTCCTCTCC
CGCTGCTCCGGCGACTGGAGGCTCGCCGTCTCCTCCTCCGACCTCCCCTCCCGCCTCTCC
CCCGCCGCCATCTCCTCCCTCGTCCGACGACGCCCGTCCCCCTCCTCCCCGCGCCTCCAC
CCTAAGCTCCTCCTCGACTTCTTCTACTGGTCCAGCCCCCAGCTCGCGCCGTCGGCCCCC
GCCCCCGATGCCTTCGCCCACCTGGCCATGTCCCTGTGCGCCGGCTCACTCTTCAACCTG
GCCAACGGCCTCCTCATCAAGATGATCCGCGCCTACCCGTCACCTCCCGTCGTCCTCGCC
TCCATCCATCGCGCGCTATCGGATTCTGGCCACCGTTCGCCGGCGGTGCTCGACGTCCTC
GTGGATACCTACAAGAAGTCTGGGAGGGTGCAGGACGCCGCGGAGGTCGTCCTGATGATG
AGAGATCGGGGCATGGCTCCCAGCATTCGGTGCTGCAACGCGCTGTTGAAGGATCTGCTG
CGCGCGGACGCCATGGCTCTGCTTTGGAAGGTGCGAGAGTTCATGGTTGGCGCTGGGATT
TCCCCGGATGTGTATACGTACTCGACTCTGATCGAAGCCTACTGCAAGGTCCGGGAATTT
GATACTGCCAAGAAGGTGCTTGTGGAAATGCGTGAGAGGGGGTGCGGCCTGAACACCGTA
ACCTACAATGTGCTGATTGCTGGGTTATGCAGGTCTGGGGCTGTCGAAGAGGCGTTTGGG
TTCAAGAAGGACATGGAGGATTATGGACTAGTTCCTGACGGGTTTACCTATGGCGCACTC
ATTAATGGACTGTGCAAGAGCCGTAGGTCAAATGAGGCGAAGGCATTGTTGGACGAGATG
TCTTGTGCTGAGCTAAAGCCTAATGTCGTAGTTTATGCCAATCTGATTGATGGGTTTATG
AGGGAGGGCAATGCAGATGAGGCGTTTAAGATGATAAAGGAGATGGTTGCTGCTGGTGTG
CAGCCAAACAAAATTACCTATGACAATCTTGTTCGGGGACTATGTAAGATGGGGCAGATG
GACAGGGCTTCTCTACTTTTGAAGCAAATGGTCAGAGATAGCCATAGGCCTGATACCATC
ACGTACAATCTCATTATTGAAGGACATTTCCGTCATCATAGCAAAAAGGATGCTTTTCGG
CTTCTTAGTGAAATGGAGAATGCTGGTATTTCCCCTAATGTATATACTTATAGCATAATG
ATTCATGGGCTATGCCAAAGTGGTGAACCAGAAAAGGCAAGTGATCTCCTTGAGGAAATG
ACTACAAAAGGATTGAAGCCTAATGCATTTGTTTATGCGCCTCTTATCTCAGGGTACTGT
AGAGAAGGTAATGTTTCATTGGCATGTGAAATTTTTGATAAGATGACAAAGGTGAATGTA
CTCCCTGATTTGTACTGCTACAATTCTCTTATATTTGGACTATCTAAGGTGGGAAGGGTG
GAGGAATCTACAAAGTACTTTGCTCAGATGCAGGAGAGAGGATTGCTGCCAAATGAATTC
ACATACAGTGGCCTCATTCATGGGTATCTAAAGAATGGTGATCTAGAAAGTGCTGAACAG
TTAGTGCAGCGGATGCTTGACACTGGACTAAAACCAAATGATGTTATCTACATTGATCTC
CTAGAAAGCTACTTTAAGTCAGATGATATTGAAAAGGTGTCCTCTACTTTCAAGTCCATG
TTAGACCAGGGAGTTATGCTTGACAACCGTATCTATGGAATCTTGATTCATAATCTGTCC
AGTTCTGGAAATATGGAAGCAGCATTTAGGGTTCTTTCAGGGATTGAGAAGAATGGATCT
GTTCCGGATGTGCATGTGTACAGCTCGTTGATATCAGGTCTTTGCAAGACAGCTGACAGG
GAAAAAGCTTTTGGTATTCTTGATGAAATGTCTAAGAAGGGAGTAGATCCTAATATTGTA
TGCTATAATGCCCTAATTGATGGGCTGTGCAAGTCTGGTGATATTTCTTATGCCCGCAAT
GTCTTCAATAGCATATTAGCTAAGGGATTAGTGCCAAACTGTGTGACATACACAAGTTTG
ATTGATGGAAGCTGCAAAGTTGGTGACATCAGCAATGCATTCTATCTTTATAATGAAATG
CTAGCAACAGGTATAACACCAGATGCTTTTGTCTATAGTGTACTTACCACTGGCTGCTCT
AGTGCTGGTGACCTTGAGCAGGCAATGTTTCTGATTGAGGAAATGTTTCTTAGGGGACAT
GCAAGTATTTCTTCTTTCAATAATTTAGTTGATGGTTTCTGCAAACGTGGAAAGATGCAG
GAAACTTTGAAGTTGTTGCATGTGATAATGGGCAGGGGCCTAGTACCTAATGCCCTGACT
ATTGAAAACATCATCAGTGGACTTAGTGAGGCTGGAAAACTCAGTGAAGTGCACACAATT
TTTGTTGAGTTGCAGCAGAAAACTTCAGAAAGCGCTGCCCGCCACTTTTCCTCATTGTTT
ATGGACATGATAAATCAAGGAAAAATTCCTCTTGATGTGGTTGATGACATGATTCGAGAT
CATTGTAAAGAAGGAAATCTGGACAAGGCTTTAATGCTGCGAGATGTTATTGTTGCGAAA
AGTGCACCAATGGGCTGCTCGTCCTATCTTGCTATAGTGGACAATCTATGCCGGAAGGGA
AAATTAAGTGAAGCGTTGAATTTGCTGAAAGAAATGGACAAGAGAGGTATTTGTCCCAGT
GAGAATCAATGCTTGATACTATTAACTAATCTTCATACATCTGGATATATCCAAGAACAC
AATACGGTACTTGATAATATGTTGTGTCACAAGTGGTTACAGAAGGACAGCAAATTCTGT
AATTCAGCTGGTGATAATCTGGAATCTGTCAATGCAGAATAA

Protein

1014 aa

>Os07t0300200-01 Pentatricopeptide repeat domain containing protein.
MLLAARGRRHPFAAARLLPIPLSSGPSFASSTTTTTSNGACSSSAADPDAVAAEVATLLS
RCSGDWRLAVSSSDLPSRLSPAAISSLVRRRPSPSSPRLHPKLLLDFFYWSSPQLAPSAP
APDAFAHLAMSLCAGSLFNLANGLLIKMIRAYPSPPVVLASIHRALSDSGHRSPAVLDVL
VDTYKKSGRVQDAAEVVLMMRDRGMAPSIRCCNALLKDLLRADAMALLWKVREFMVGAGI
SPDVYTYSTLIEAYCKVREFDTAKKVLVEMRERGCGLNTVTYNVLIAGLCRSGAVEEAFG
FKKDMEDYGLVPDGFTYGALINGLCKSRRSNEAKALLDEMSCAELKPNVVVYANLIDGFM
REGNADEAFKMIKEMVAAGVQPNKITYDNLVRGLCKMGQMDRASLLLKQMVRDSHRPDTI
TYNLIIEGHFRHHSKKDAFRLLSEMENAGISPNVYTYSIMIHGLCQSGEPEKASDLLEEM
TTKGLKPNAFVYAPLISGYCREGNVSLACEIFDKMTKVNVLPDLYCYNSLIFGLSKVGRV
EESTKYFAQMQERGLLPNEFTYSGLIHGYLKNGDLESAEQLVQRMLDTGLKPNDVIYIDL
LESYFKSDDIEKVSSTFKSMLDQGVMLDNRIYGILIHNLSSSGNMEAAFRVLSGIEKNGS
VPDVHVYSSLISGLCKTADREKAFGILDEMSKKGVDPNIVCYNALIDGLCKSGDISYARN
VFNSILAKGLVPNCVTYTSLIDGSCKVGDISNAFYLYNEMLATGITPDAFVYSVLTTGCS
SAGDLEQAMFLIEEMFLRGHASISSFNNLVDGFCKRGKMQETLKLLHVIMGRGLVPNALT
IENIISGLSEAGKLSEVHTIFVELQQKTSESAARHFSSLFMDMINQGKIPLDVVDDMIRD
HCKEGNLDKALMLRDVIVAKSAPMGCSSYLAIVDNLCRKGKLSEALNLLKEMDKRGICPS
ENQCLILLTNLHTSGYIQEHNTVLDNMLCHKWLQKDSKFCNSAGDNLESVNAE*

5'UTR

chr07:11845814..11845861 (+ strand) : 48 bp

CDS

chr07:11845862..11848903 (+ strand) : 3042 bp

3'UTR

chr07:11848904..11849019 (+ strand) : 116 bp

FASTA

>Os07t0300200-01 class=Sequence position=chr07:11845814..11849019 (+ strand)
ACAGAAGATC CCGTTCCCGT GCTCTGTTGC CAATTCTCCC CCACCACCAT GCTCCTCGCC GCGCGCGGCC GCCGTCACCC
CTTCGCCGCC GCGCGCCTCC TTCCGATCCC GCTTTCCTCC GGCCCCTCCT TCGCCTCCTC CACCACCACC ACGACCTCCA
ATGGCGCCTG TTCGTCCTCC GCCGCGGACC CCGACGCCGT GGCCGCCGAG GTGGCCACCC TCCTCTCCCG CTGCTCCGGC
GACTGGAGGC TCGCCGTCTC CTCCTCCGAC CTCCCCTCCC GCCTCTCCCC CGCCGCCATC TCCTCCCTCG TCCGACGACG
CCCGTCCCCC TCCTCCCCGC GCCTCCACCC TAAGCTCCTC CTCGACTTCT TCTACTGGTC CAGCCCCCAG CTCGCGCCGT
CGGCCCCCGC CCCCGATGCC TTCGCCCACC TGGCCATGTC CCTGTGCGCC GGCTCACTCT TCAACCTGGC CAACGGCCTC
CTCATCAAGA TGATCCGCGC CTACCCGTCA CCTCCCGTCG TCCTCGCCTC CATCCATCGC GCGCTATCGG ATTCTGGCCA
CCGTTCGCCG GCGGTGCTCG ACGTCCTCGT GGATACCTAC AAGAAGTCTG GGAGGGTGCA GGACGCCGCG GAGGTCGTCC
TGATGATGAG AGATCGGGGC ATGGCTCCCA GCATTCGGTG CTGCAACGCG CTGTTGAAGG ATCTGCTGCG CGCGGACGCC
ATGGCTCTGC TTTGGAAGGT GCGAGAGTTC ATGGTTGGCG CTGGGATTTC CCCGGATGTG TATACGTACT CGACTCTGAT
CGAAGCCTAC TGCAAGGTCC GGGAATTTGA TACTGCCAAG AAGGTGCTTG TGGAAATGCG TGAGAGGGGG TGCGGCCTGA
ACACCGTAAC CTACAATGTG CTGATTGCTG GGTTATGCAG GTCTGGGGCT GTCGAAGAGG CGTTTGGGTT CAAGAAGGAC
ATGGAGGATT ATGGACTAGT TCCTGACGGG TTTACCTATG GCGCACTCAT TAATGGACTG TGCAAGAGCC GTAGGTCAAA
TGAGGCGAAG GCATTGTTGG ACGAGATGTC TTGTGCTGAG CTAAAGCCTA ATGTCGTAGT TTATGCCAAT CTGATTGATG
GGTTTATGAG GGAGGGCAAT GCAGATGAGG CGTTTAAGAT GATAAAGGAG ATGGTTGCTG CTGGTGTGCA GCCAAACAAA
ATTACCTATG ACAATCTTGT TCGGGGACTA TGTAAGATGG GGCAGATGGA CAGGGCTTCT CTACTTTTGA AGCAAATGGT
CAGAGATAGC CATAGGCCTG ATACCATCAC GTACAATCTC ATTATTGAAG GACATTTCCG TCATCATAGC AAAAAGGATG
CTTTTCGGCT TCTTAGTGAA ATGGAGAATG CTGGTATTTC CCCTAATGTA TATACTTATA GCATAATGAT TCATGGGCTA
TGCCAAAGTG GTGAACCAGA AAAGGCAAGT GATCTCCTTG AGGAAATGAC TACAAAAGGA TTGAAGCCTA ATGCATTTGT
TTATGCGCCT CTTATCTCAG GGTACTGTAG AGAAGGTAAT GTTTCATTGG CATGTGAAAT TTTTGATAAG ATGACAAAGG
TGAATGTACT CCCTGATTTG TACTGCTACA ATTCTCTTAT ATTTGGACTA TCTAAGGTGG GAAGGGTGGA GGAATCTACA
AAGTACTTTG CTCAGATGCA GGAGAGAGGA TTGCTGCCAA ATGAATTCAC ATACAGTGGC CTCATTCATG GGTATCTAAA
GAATGGTGAT CTAGAAAGTG CTGAACAGTT AGTGCAGCGG ATGCTTGACA CTGGACTAAA ACCAAATGAT GTTATCTACA
TTGATCTCCT AGAAAGCTAC TTTAAGTCAG ATGATATTGA AAAGGTGTCC TCTACTTTCA AGTCCATGTT AGACCAGGGA
GTTATGCTTG ACAACCGTAT CTATGGAATC TTGATTCATA ATCTGTCCAG TTCTGGAAAT ATGGAAGCAG CATTTAGGGT
TCTTTCAGGG ATTGAGAAGA ATGGATCTGT TCCGGATGTG CATGTGTACA GCTCGTTGAT ATCAGGTCTT TGCAAGACAG
CTGACAGGGA AAAAGCTTTT GGTATTCTTG ATGAAATGTC TAAGAAGGGA GTAGATCCTA ATATTGTATG CTATAATGCC
CTAATTGATG GGCTGTGCAA GTCTGGTGAT ATTTCTTATG CCCGCAATGT CTTCAATAGC ATATTAGCTA AGGGATTAGT
GCCAAACTGT GTGACATACA CAAGTTTGAT TGATGGAAGC TGCAAAGTTG GTGACATCAG CAATGCATTC TATCTTTATA
ATGAAATGCT AGCAACAGGT ATAACACCAG ATGCTTTTGT CTATAGTGTA CTTACCACTG GCTGCTCTAG TGCTGGTGAC
CTTGAGCAGG CAATGTTTCT GATTGAGGAA ATGTTTCTTA GGGGACATGC AAGTATTTCT TCTTTCAATA ATTTAGTTGA
TGGTTTCTGC AAACGTGGAA AGATGCAGGA AACTTTGAAG TTGTTGCATG TGATAATGGG CAGGGGCCTA GTACCTAATG
CCCTGACTAT TGAAAACATC ATCAGTGGAC TTAGTGAGGC TGGAAAACTC AGTGAAGTGC ACACAATTTT TGTTGAGTTG
CAGCAGAAAA CTTCAGAAAG CGCTGCCCGC CACTTTTCCT CATTGTTTAT GGACATGATA AATCAAGGAA AAATTCCTCT
TGATGTGGTT GATGACATGA TTCGAGATCA TTGTAAAGAA GGAAATCTGG ACAAGGCTTT AATGCTGCGA GATGTTATTG
TTGCGAAAAG TGCACCAATG GGCTGCTCGT CCTATCTTGC TATAGTGGAC AATCTATGCC GGAAGGGAAA ATTAAGTGAA
GCGTTGAATT TGCTGAAAGA AATGGACAAG AGAGGTATTT GTCCCAGTGA GAATCAATGC TTGATACTAT TAACTAATCT
TCATACATCT GGATATATCC AAGAACACAA TACGGTACTT GATAATATGT TGTGTCACAA GTGGTTACAG AAGGACAGCA
AATTCTGTAA TTCAGCTGGT GATAATCTGG AATCTGTCAA TGCAGAATAA ACATAGAGCA GAATCCTTCC TATAAAAGAA
AGTCTGATTC TATTATTCAT GTTGCGAATG CATGTCGTAG CCTTGTTTTT GTTTATTGAT GAGGAATTAA ACAGATTAAT
TTTTTC

Locus: Os07g0300200

Loading...

Locus: Os07g0300200

Loading...