Os07t0421000-01

Locus

Os07g0421000

Description

Cyclin-like F-box domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFBX234, OsFbox369, Os_F0191

Oryzabase Gene Name Synonym(s)

F-box domain containing protein 234, F-box protein 369

Transcript Evidence

AK071522 (DDBJ, Best hit)

Protein Evidence

B8B5H2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

F-box domain, cyclin-like (IPR001810)

F-box domain, Skp2-like (IPR022364)

Full-length cDNA

J023099N14 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0421000-01)

RiceXPro (AK071522)

Others

Oryzabase (11569)

KEGG (Os07t0421000-01)

Transcript

1530 bp

>Os07t0421000-01 Cyclin-like F-box domain containing protein.
GGTCAGCTTCGAACCCAGGCAAGTAGAAGAACCCCCAAATTCCCCCTTGTCGGcctatcc
ccacccaaaaccctcgcgtccacccgcccccgccgccgacgacctcgccagaggagctca
tggacgacgccatcgccgcgctcccgccggagctcgtctccgagatcctcctccgcctcc
ggccggacgagcccgagcacctcttccgcgcgtcactcgtctgcaaggcatggctccgcg
ccatctgcgaccccgtcttcctccgccgctaccgcgccttccacggatccccgccgctgc
tcggcctcctccacaggctccgggtcatagacggggaccccgccccgcgcctcgcccgca
ccacggcggcgcccctctcccccgacccggccttcctccgggccctcgactgccgccatg
gccgcgtcctcctccacgcgtcgaacctcggcctcatcgtctgggaccccgtcacgggcg
agcagcaccgcctgccggaatctggcatcccgtggctgatctacaccgccgcagtgttct
gcgccgtcggcggctgtgaccacctcgactgccacggcggccccttccgagtggtcttcg
tggccaccgacgacgacgacgaactcgtcaaggggagtgtgtattcatcggagaccggtg
tgtggagcacgccagcaactcttgatgatggctatcaatcctgggaagagcgttggcagg
cggcccgcagtagaggcgaatactaccgcacaccttatgtccatcctaagcgatgtgccc
ttgtcggagatgaaatctacttcacacttcggaacggcaatacgatcatcgagtacaact
ggggaaagaaccgcttatctatgtttgacccgccgacatcggacttgtactacattgccc
tcacggtgatggagaatggttcactggggtttgccggcattgagggatccagccttaatg
tgtggtcgaggaaggtgaatccacaaggggctgcagaatgggtactatgcaggatcatcg
aactggagaaaattatacctgtagtcgatctcagtgatgaagcatgtgtggttggctctg
cagagggtctgggtgtcatcttcgtgagcacaggcgttggcttattcacgatcgagctca
agtcAAGGCGGGTGAAGAAGCTTGAAGAGCCTGGTGTCTACTTTAGTGTCTTACCCTACA
TGAGCTTCTACACTCCTGATCGTGGCACATTGTTATCGCTAGCAAGGACTCACTGATCTT
TGATCTCATGCTCAAGAGTAACATGTTGCAAAATGGACAAATCCATCGTCTTGGATCTGC
TGCGATTGACATCTTCCAGAGATACTACTATGAAGTTGTTTATTTTCTGTTGGGCAATGT
AGGTATGAGCAATTCGAGTCATCATGTTCGAATATGGTCATCGTATCAAATTCATCAACC
ATGAACTGTATTCGGTTTAACATGTCTGGCATATTTCAGTTACTTTTTGGTTTATATTGG
GCTAAGGTACATGAAACAAAAATTATATTC

CDS

1137 bp

>Os07t0421000-01 Cyclin-like F-box domain containing protein.
atggacgacgccatcgccgcgctcccgccggagctcgtctccgagatcctcctccgcctc
cggccggacgagcccgagcacctcttccgcgcgtcactcgtctgcaaggcatggctccgc
gccatctgcgaccccgtcttcctccgccgctaccgcgccttccacggatccccgccgctg
ctcggcctcctccacaggctccgggtcatagacggggaccccgccccgcgcctcgcccgc
accacggcggcgcccctctcccccgacccggccttcctccgggccctcgactgccgccat
ggccgcgtcctcctccacgcgtcgaacctcggcctcatcgtctgggaccccgtcacgggc
gagcagcaccgcctgccggaatctggcatcccgtggctgatctacaccgccgcagtgttc
tgcgccgtcggcggctgtgaccacctcgactgccacggcggccccttccgagtggtcttc
gtggccaccgacgacgacgacgaactcgtcaaggggagtgtgtattcatcggagaccggt
gtgtggagcacgccagcaactcttgatgatggctatcaatcctgggaagagcgttggcag
gcggcccgcagtagaggcgaatactaccgcacaccttatgtccatcctaagcgatgtgcc
cttgtcggagatgaaatctacttcacacttcggaacggcaatacgatcatcgagtacaac
tggggaaagaaccgcttatctatgtttgacccgccgacatcggacttgtactacattgcc
ctcacggtgatggagaatggttcactggggtttgccggcattgagggatccagccttaat
gtgtggtcgaggaaggtgaatccacaaggggctgcagaatgggtactatgcaggatcatc
gaactggagaaaattatacctgtagtcgatctcagtgatgaagcatgtgtggttggctct
gcagagggtctgggtgtcatcttcgtgagcacaggcgttggcttattcacgatcgagctc
aagtcAAGGCGGGTGAAGAAGCTTGAAGAGCCTGGTGTCTACTTTAGTGTCTTACCCTAC
ATGAGCTTCTACACTCCTGATCGTGGCACATTGTTATCGCTAGCAAGGACTCACTGA

Protein

379 aa

>Os07t0421000-01 Cyclin-like F-box domain containing protein.
MDDAIAALPPELVSEILLRLRPDEPEHLFRASLVCKAWLRAICDPVFLRRYRAFHGSPPL
LGLLHRLRVIDGDPAPRLARTTAAPLSPDPAFLRALDCRHGRVLLHASNLGLIVWDPVTG
EQHRLPESGIPWLIYTAAVFCAVGGCDHLDCHGGPFRVVFVATDDDDELVKGSVYSSETG
VWSTPATLDDGYQSWEERWQAARSRGEYYRTPYVHPKRCALVGDEIYFTLRNGNTIIEYN
WGKNRLSMFDPPTSDLYYIALTVMENGSLGFAGIEGSSLNVWSRKVNPQGAAEWVLCRII
ELEKIIPVVDLSDEACVVGSAEGLGVIFVSTGVGLFTIELKSRRVKKLEEPGVYFSVLPY
MSFYTPDRGTLLSLARTH*

5'UTR

chr07:13515658..13515776 (- strand) : 119 bp

CDS

chr07:13514559..13515657 (- strand) : 1099 bp

chr07:13513910..13513947 (- strand) : 38 bp

3'UTR

chr07:13513636..13513909 (- strand) : 274 bp

FASTA

>Os07t0421000-01 class=Sequence position=chr07:13513636..13515776 (- strand)
GGTCAGCTTC GAACCCAGGC AAGTAGAAGA ACCCCCAAAT TCCCCCTTGT CGGcctatcc ccacccaaaa ccctcgcgtc
cacccgcccc cgccgccgac gacctcgcca gaggagctca tggacgacgc catcgccgcg ctcccgccgg agctcgtctc
cgagatcctc ctccgcctcc ggccggacga gcccgagcac ctcttccgcg cgtcactcgt ctgcaaggca tggctccgcg
ccatctgcga ccccgtcttc ctccgccgct accgcgcctt ccacggatcc ccgccgctgc tcggcctcct ccacaggctc
cgggtcatag acggggaccc cgccccgcgc ctcgcccgca ccacggcggc gcccctctcc cccgacccgg ccttcctccg
ggccctcgac tgccgccatg gccgcgtcct cctccacgcg tcgaacctcg gcctcatcgt ctgggacccc gtcacgggcg
agcagcaccg cctgccggaa tctggcatcc cgtggctgat ctacaccgcc gcagtgttct gcgccgtcgg cggctgtgac
cacctcgact gccacggcgg ccccttccga gtggtcttcg tggccaccga cgacgacgac gaactcgtca aggggagtgt
gtattcatcg gagaccggtg tgtggagcac gccagcaact cttgatgatg gctatcaatc ctgggaagag cgttggcagg
cggcccgcag tagaggcgaa tactaccgca caccttatgt ccatcctaag cgatgtgccc ttgtcggaga tgaaatctac
ttcacacttc ggaacggcaa tacgatcatc gagtacaact ggggaaagaa ccgcttatct atgtttgacc cgccgacatc
ggacttgtac tacattgccc tcacggtgat ggagaatggt tcactggggt ttgccggcat tgagggatcc agccttaatg
tgtggtcgag gaaggtgaat ccacaagggg ctgcagaatg ggtactatgc aggatcatcg aactggagaa aattatacct
gtagtcgatc tcagtgatga agcatgtgtg gttggctctg cagagggtct gggtgtcatc ttcgtgagca caggcgttgg
cttattcacg atcgagctca agtcAAGGCG GGTGAAGAAG CTTGAAGAGC CTGGTGTCTA CTTTAGTGTC TTACCCTACA
TGAGCTTCTA CACTCCTGGT AGTGTACTGA ACCTTGCTTG TCTATTTTCC TGCATTTTCT TTACAGCTTC TATATATTTG
CTTAGTCACA ATGTAACTGC TATTCTGTTA TACTGATTGA CCAAGACCGT TTTGTGTATA TGAGAGAATA CTGGATATAT
GGCATTGGAA ATCAGAACCT GAATGTTTTT AATGAGATCT TACCTGTTAA GAACCATGAA CATACATTGG TCCAGTTGCT
ATTATGCATA CAAACTTTGT TGATATGATA TTATATGTTA CCTACTAGAA AAAATTCTAT TATTTCTGGC ATAGATGAAG
CTAACTTCTC AGCCTCTGTT ATTTCGTGGA ATTGCTGATG TAGTTGATGA AGCATGAAAT GGCTATTAGG TTAAAATGGA
TATTGCTAAA TATTTAAAGA ACCTTGTTGA TATAGTACTA ATCCTTTTGC CTTGCTTCAG ATTTTCTTTA CAAATTATTA
TGTTACATTC TGACATAGCT GAAGCTCAGA TCTCATACCC AATCTAGTAA CTTTGGAATT ACTTCTAAGT ACATAGCTCG
TCAAATTGTA AATTTTGAGC TGGACAGTTG GTTCTGAGTT GTGTGCTTAC CTACTTGGTG TCTTTTCAGA TCGTGGCACA
TTGTTATCGC TAGCAAGGAC TCACTGATCT TTGATCTCAT GCTCAAGAGT AACATGTTGC AAAATGGACA AATCCATCGT
CTTGGATCTG CTGCGATTGA CATCTTCCAG AGATACTACT ATGAAGTTGT TTATTTTCTG TTGGGCAATG TAGGTATGAG
CAATTCGAGT CATCATGTTC GAATATGGTC ATCGTATCAA ATTCATCAAC CATGAACTGT ATTCGGTTTA ACATGTCTGG
CATATTTCAG TTACTTTTTG GTTTATATTG GGCTAAGGTA CATGAAACAA AAATTATATT C

Locus: Os07g0421000

Loading...

Locus: Os07g0421000

Loading...